KEGG   Thermaerobacter marianensis: Tmar_1451Help
Entry
Tmar_1451         CDS       T01388                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmar_1451
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmar_1451
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmar_1451
Enzymes [BR:tmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmar_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1737624..1738901)
Genome map
AA seq 425 aa AA seqDB search
MGNVAANPAGAAGKTAVPAQEGAVPDARGYFGPFGGRFVPETVIPALAELEQAYEEAMAD
PAFRAELDGYLAEFCGRPTPLYRADRLAAACGNPGVRVYLKREDLNHTGAHKINNALGQA
LLARRMGKRRVIAETGAGQHGVATATAAAVLGLECEVFMGAEDMRRQQLNVFRMELLGAR
VRPVTSGTATLKDATNEAIRHWVTHVRTTHYVIGSVVGPHPYPRIVRDFQAVIGREARAQ
VLEREGRLPDVLVACVGGGSNAMGLFYPFVGDAGVAMIGVEAAGEGLETGRHAASLTAGR
PGILHGALSYLLQDEDGQVRPAHSVSAGLDYPGVGPEHAYLKATGRARYEAVTDQEALEA
FELLCRTEGIVPALESAHAIAYLRRLLPELPAGSVVVVCLSGRGDKDVAEVARLRGGAAG
KEEGR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgtcgcagcgaatcccgccggggcggcgggaaagacggcggtaccggcccag
gagggcgccgtgcccgatgcccggggctacttcggccccttcggcggccggttcgtcccg
gagacggtgatcccggccctggcggaactggagcaggcctacgaagaggccatggccgat
ccggccttccgggcggaactggacggttacctggccgagttctgcgggcggcccacgccc
ctctaccgggccgaccggctggcggcggcctgcggcaaccccggggtccgggtctacctc
aagcgggaagacctcaaccacaccggcgcccacaagatcaacaacgccctgggccaggcg
ctgctggcacggcgcatgggcaagcggcgggtcatcgccgagacgggggcggggcagcac
ggcgtggccacggccacggcggcggcggtgctgggcctcgagtgcgaggtgttcatgggt
gccgaggacatgcggcgccagcagctcaacgtcttccgcatggagctattgggcgcccgg
gtgcggcccgtgacctcgggcaccgccaccctgaaggacgccaccaacgaggcgatccgc
cactgggtcacccacgtccggacgacccactacgtcatcgggtcggtggtggggccgcat
ccctacccgcgcatcgtgcgcgacttccaagcggtgatcggccgggaggccagggcccag
gtgctggagcgggagggccggttgcccgacgtgctggtggcctgcgtgggcggcggcagc
aacgccatgggcctgttctaccccttcgtgggcgacgcgggggtcgccatgatcggcgtg
gaggccgcgggggagggactcgagaccgggcgtcacgcggcgtccttgaccgccgggcgg
ccggggatcctgcacggcgccctgagctacctcctccaggacgaggacggccaggtgcgg
ccggcccactcggtctccgcgggcctcgactatccgggtgtggggcccgagcacgcctac
ctcaaggccacgggccgggcgcggtacgaggcggtgaccgaccaggaggcgctggaggct
ttcgagctcctctgccggacggaggggatcgtcccggccctggagagcgcccacgccatc
gcctacctgcggcggttgctgcccgagctgccggcgggcagcgtggtggtggtgtgcctc
tcgggccggggcgacaaggacgtggccgaggtggcgcggctccgcggcggcgccgcggga
aaggaggaagggcgatga

DBGET integrated database retrieval system