KEGG   Thermaerobacter marianensis: Tmar_1634Help
Entry
Tmar_1634         CDS       T01388                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tmr  Thermaerobacter marianensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:tmr00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1973684..1974322
Genome map
AA seq 212 aa AA seqDB search
MDLQQSGAAAAAQDPAAALVVVDVQNDFCPGGALAVPEGDRVVPALNRWVDAFHRAGRVV
VYTQDWHPENHVSFRARGGPWPVHCVQGTRGAAFHPDLAVRGVVFRKGFDPDREAYSGFD
GALAEGERDVRPETGLAAWLREQGVRRLYVGGLATDYCVRATVLDALREGFQVTVLVPAV
RAVDVTPGDGRRALEEMQARGAVLAGDEGESA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacctccagcagtccggcgccgccgccgcagcccaggacccggcagccgccctggtg
gtggtggacgtccagaacgacttctgccccgggggcgccctggccgtccccgagggggac
cgggtggtaccggccctcaaccggtgggtcgacgccttccaccgcgccggccgcgtggtg
gtctacacccaggactggcacccggagaaccacgtcagcttccgcgcccggggcgggccg
tggccggtccattgcgtccagggaacccgcggcgccgccttccaccccgatctggcggtg
cggggcgtggtgttccgcaagggattcgacccggaccgggaagcctacagcggcttcgac
ggcgccctggccgaaggcgagcgggacgtccggccagagaccgggctggccgcctggctg
cgggagcagggggtgcggcggctctacgtgggcggcctggccacggactactgcgtccgc
gccacggtcctggacgccctgcgggaggggttccaggtcacggtgctggtccccgccgtg
cgggcggtggacgtgacacccggcgacgggcggcgggccctggaggagatgcaggcacgg
ggcgccgtgctggccggtgacgagggggagtccgcgtga

DBGET integrated database retrieval system