KEGG   Thermaerobacter marianensis: Tmar_1634Help
Entry
Tmar_1634         CDS       T01388                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00760  Nicotinate and nicotinamide metabolism
tmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Tmar_1634
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Tmar_1634
    3.5.1.-  
     Tmar_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase Sulfatase
Motif
Other DBs
NCBI-ProteinID: ADU51743
JGI: Tmar_1634
UniProt: E6SH79
Position
1973684..1974322
Genome map
AA seq 212 aa AA seqDB search
MDLQQSGAAAAAQDPAAALVVVDVQNDFCPGGALAVPEGDRVVPALNRWVDAFHRAGRVV
VYTQDWHPENHVSFRARGGPWPVHCVQGTRGAAFHPDLAVRGVVFRKGFDPDREAYSGFD
GALAEGERDVRPETGLAAWLREQGVRRLYVGGLATDYCVRATVLDALREGFQVTVLVPAV
RAVDVTPGDGRRALEEMQARGAVLAGDEGESA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacctccagcagtccggcgccgccgccgcagcccaggacccggcagccgccctggtg
gtggtggacgtccagaacgacttctgccccgggggcgccctggccgtccccgagggggac
cgggtggtaccggccctcaaccggtgggtcgacgccttccaccgcgccggccgcgtggtg
gtctacacccaggactggcacccggagaaccacgtcagcttccgcgcccggggcgggccg
tggccggtccattgcgtccagggaacccgcggcgccgccttccaccccgatctggcggtg
cggggcgtggtgttccgcaagggattcgacccggaccgggaagcctacagcggcttcgac
ggcgccctggccgaaggcgagcgggacgtccggccagagaccgggctggccgcctggctg
cgggagcagggggtgcggcggctctacgtgggcggcctggccacggactactgcgtccgc
gccacggtcctggacgccctgcgggaggggttccaggtcacggtgctggtccccgccgtg
cgggcggtggacgtgacacccggcgacgggcggcgggccctggaggagatgcaggcacgg
ggcgccgtgctggccggtgacgagggggagtccgcgtga

DBGET integrated database retrieval system