KEGG   Thermaerobacter marianensis: Tmar_1634Help
Entry
Tmar_1634         CDS       T01388                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tmr  Thermaerobacter marianensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Tmar_1634
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Tmar_1634
    3.5.1.-  
     Tmar_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1973684..1974322
Genome map
AA seq 212 aa AA seqDB search
MDLQQSGAAAAAQDPAAALVVVDVQNDFCPGGALAVPEGDRVVPALNRWVDAFHRAGRVV
VYTQDWHPENHVSFRARGGPWPVHCVQGTRGAAFHPDLAVRGVVFRKGFDPDREAYSGFD
GALAEGERDVRPETGLAAWLREQGVRRLYVGGLATDYCVRATVLDALREGFQVTVLVPAV
RAVDVTPGDGRRALEEMQARGAVLAGDEGESA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacctccagcagtccggcgccgccgccgcagcccaggacccggcagccgccctggtg
gtggtggacgtccagaacgacttctgccccgggggcgccctggccgtccccgagggggac
cgggtggtaccggccctcaaccggtgggtcgacgccttccaccgcgccggccgcgtggtg
gtctacacccaggactggcacccggagaaccacgtcagcttccgcgcccggggcgggccg
tggccggtccattgcgtccagggaacccgcggcgccgccttccaccccgatctggcggtg
cggggcgtggtgttccgcaagggattcgacccggaccgggaagcctacagcggcttcgac
ggcgccctggccgaaggcgagcgggacgtccggccagagaccgggctggccgcctggctg
cgggagcagggggtgcggcggctctacgtgggcggcctggccacggactactgcgtccgc
gccacggtcctggacgccctgcgggaggggttccaggtcacggtgctggtccccgccgtg
cgggcggtggacgtgacacccggcgacgggcggcgggccctggaggagatgcaggcacgg
ggcgccgtgctggccggtgacgagggggagtccgcgtga

DBGET integrated database retrieval system