KEGG   Thermaerobacter marianensis: Tmar_1690Help
Entry
Tmar_1690         CDS       T01388                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tmr  Thermaerobacter marianensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ADU51799
JGI: Tmar_1690
UniProt: E6SHK4
Position
complement(2028917..2030074)
Genome map
AA seq 385 aa AA seqDB search
MATPAEQAGGQPGVPAGGQAGGESRLIGFLRDLTQTYGPSGREDAVREYIRARIEPWADE
VRVDALGNLIARRAPRGTGADAAGPGTPAAAGSAGGAEGPGGRGAGRRIMIAAHMDEIAV
IATHIDDKGFIRVEPVGGQDPMVLLGQRVEFAGGVVGVVGSEKLDDARDLKMGKLFVDIG
ATSGDDARRRVRVGDMAVFHRPLERAGDRLIAKALDDRSGCAVVMEAMARLEASPHEIFF
VFTVQEEVGLRGARTAAYGVEPDVAVAVDITLAGDTPEPQHRVAVELGKGPAIKVKDNSQ
IAHPLVRRWMEGAAEAEGIPYQLEVLPFGGTDAGAMQLARAGVPAGTLSIPVRYGHTPGE
MADVRDLENAVRLLVAMLSRPLPEA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccccagctgagcaggccggagggcagcccggcgtcccggccggtggacaggcc
ggcggcgagtcacgtctgatcggtttcctccgcgacctgacccagacctacggcccctcg
ggccgggaagacgcggtgcgcgagtacatccgcgcccggatcgaaccgtgggcggacgaa
gtgcgcgtcgacgccctgggcaacttgatcgcccggcgcgcgccgcgggggaccggggcg
gatgcggccggtcccggcacccctgcagccgccgggtccgcaggaggtgccgaggggcct
gggggccgcggggccggccggcgcatcatgatcgctgcccatatggacgagatcgccgtc
atcgccacccacatcgacgacaagggcttcatccgcgtggagcccgtgggtgggcaggat
cccatggtgctcctgggccagcgggtggagttcgccggcggcgtggtcggcgtggtgggc
agcgagaagctggacgatgcccgcgacctgaagatgggcaagctgttcgtggacatcggt
gccacgtcgggcgatgacgcgcgccggcgcgtgcgggttggcgacatggccgtgttccac
cggcccctggaacgtgcgggcgaccggctgatcgccaaggccctggacgaccggtcgggc
tgcgcggtggtgatggaggccatggcgcggctggaggcgtcgccccacgagatcttcttc
gtgttcaccgtgcaggaggaggtgggcctgcggggcgcgcgcaccgcggcctacggcgtg
gagcccgacgtggcggtggccgtggacatcaccctggcgggggacacgcccgagccccag
caccgggtggcggtggaactcggcaaggggccggccatcaaggtgaaggacaacagccag
atcgcccacccgctggtgcggcggtggatggagggcgccgccgaggccgagggcatcccg
taccagctggaggtcctgcccttcggcggcaccgacgcgggcgccatgcagctggcacgg
gccggcgtcccggcgggcaccctgtccatcccggtccggtacggtcacacgccgggcgag
atggcggacgtccgcgacctggagaacgccgtgcgcctgctggtggccatgctgtcccgg
cccttgccggaggcgtag

DBGET integrated database retrieval system