KEGG   Thermaerobacter marianensis: Tmar_1691Help
Entry
Tmar_1691         CDS       T01388                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
tmr  Thermaerobacter marianensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2030058..2031092)
Genome map
AA seq 344 aa AA seqDB search
MLLARLSEARGVSGDEAAVRELILEAVLPSIDAYRIDSMGNLLVVKGKNKSGPRVMVAAH
MDEVGLMITRVEKNGLLRFAKVGGLDDRLLPGKRVRVGPDGVPGVIGSKPIHLDRRASSV
TPSDELYIDIGATSREAAEKLVRPGHYATFDTAFGEFGQGCWKGKAFDDRVGCALLIELL
RGDYDFPLYGAFTVQEEVGLRGAATAAYAIHPDVALVLEGTTCADIPGADEHGQSTRLGH
GPAITAMDRTVIPPRWLTDRLVAAAERRGIPYQWKRTTFGGTDAGRIHQVRAGVPSAVVS
VPCRYIHSPCAVMSRQDFENAQQLVRGFLEDLNEGGVPRHGDPS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctggcgcggctcagtgaggcccggggcgtctccggtgacgaggcggcggtccgc
gagctgatcctcgaggcggtcctgccctccatcgacgcgtaccgcatcgacagcatgggg
aacctgctggtcgtcaaggggaagaacaagtccggcccgcgggtcatggtcgccgcccac
atggacgaggtcggcctgatgatcacccgggtggagaagaacggccttctgcgcttcgcc
aaggtgggcggcctggacgaccgcctgctgcctggcaaacgggtgcgggtggggcccgac
ggggtcccgggggtcatcggcagcaagccgatccacctggaccgcagggcgagcagtgtg
accccctcggacgagctctacatcgacatcggcgccacctcccgcgaggcggcggagaag
ctggtgcgccccgggcactacgccaccttcgatacggccttcggcgagttcggccagggc
tgctggaagggcaaggccttcgacgaccgggtgggctgcgccctgctgatcgagctgctc
cggggcgactacgacttccccctctacggcgccttcacggtgcaggaggaggtcgggctg
cggggcgccgccacggcggcctacgccatccaccccgacgtggcgctggtgctggagggc
accacctgcgccgacatccccggcgcggacgaacacggccagtccacccgcctgggccac
ggccccgccatcaccgccatggaccgcacggtgatcccgccgcgctggctcacggaccgg
ttggtggcggcggccgaacggcgcggcatcccgtaccagtggaagcgcaccaccttcggc
ggcaccgacgccgggcgcatccaccaggtgcgggcgggggtgccgtcggcggtggtgtcg
gtgccttgccgctacatccactcgccctgcgccgtgatgagccggcaggactttgaaaat
gcgcagcagctggtgcgcggctttctggaggacttgaacgaaggaggcgtgccccgccat
ggcgaccccagctga

DBGET integrated database retrieval system