KEGG   Thermaerobacter marianensis: Tmar_1691Help
Entry
Tmar_1691         CDS       T01388                                 

Definition
(GenBank) Cellulase
Organism
tmr  Thermaerobacter marianensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20
Motif
Other DBs
NCBI-ProteinID: ADU51800
JGI: Tmar_1691
UniProt: E6SHK5
Position
complement(2030058..2031092)
Genome map
AA seq 344 aa AA seqDB search
MLLARLSEARGVSGDEAAVRELILEAVLPSIDAYRIDSMGNLLVVKGKNKSGPRVMVAAH
MDEVGLMITRVEKNGLLRFAKVGGLDDRLLPGKRVRVGPDGVPGVIGSKPIHLDRRASSV
TPSDELYIDIGATSREAAEKLVRPGHYATFDTAFGEFGQGCWKGKAFDDRVGCALLIELL
RGDYDFPLYGAFTVQEEVGLRGAATAAYAIHPDVALVLEGTTCADIPGADEHGQSTRLGH
GPAITAMDRTVIPPRWLTDRLVAAAERRGIPYQWKRTTFGGTDAGRIHQVRAGVPSAVVS
VPCRYIHSPCAVMSRQDFENAQQLVRGFLEDLNEGGVPRHGDPS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctggcgcggctcagtgaggcccggggcgtctccggtgacgaggcggcggtccgc
gagctgatcctcgaggcggtcctgccctccatcgacgcgtaccgcatcgacagcatgggg
aacctgctggtcgtcaaggggaagaacaagtccggcccgcgggtcatggtcgccgcccac
atggacgaggtcggcctgatgatcacccgggtggagaagaacggccttctgcgcttcgcc
aaggtgggcggcctggacgaccgcctgctgcctggcaaacgggtgcgggtggggcccgac
ggggtcccgggggtcatcggcagcaagccgatccacctggaccgcagggcgagcagtgtg
accccctcggacgagctctacatcgacatcggcgccacctcccgcgaggcggcggagaag
ctggtgcgccccgggcactacgccaccttcgatacggccttcggcgagttcggccagggc
tgctggaagggcaaggccttcgacgaccgggtgggctgcgccctgctgatcgagctgctc
cggggcgactacgacttccccctctacggcgccttcacggtgcaggaggaggtcgggctg
cggggcgccgccacggcggcctacgccatccaccccgacgtggcgctggtgctggagggc
accacctgcgccgacatccccggcgcggacgaacacggccagtccacccgcctgggccac
ggccccgccatcaccgccatggaccgcacggtgatcccgccgcgctggctcacggaccgg
ttggtggcggcggccgaacggcgcggcatcccgtaccagtggaagcgcaccaccttcggc
ggcaccgacgccgggcgcatccaccaggtgcgggcgggggtgccgtcggcggtggtgtcg
gtgccttgccgctacatccactcgccctgcgccgtgatgagccggcaggactttgaaaat
gcgcagcagctggtgcgcggctttctggaggacttgaacgaaggaggcgtgccccgccat
ggcgaccccagctga

DBGET integrated database retrieval system