KEGG   Thermaerobacter marianensis: Tmar_1692Help
Entry
Tmar_1692         CDS       T01388                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tmr  Thermaerobacter marianensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2031070..2032182)
Genome map
AA seq 370 aa AA seqDB search
MDAAEVLARLAGIAGPPGHEAPVAAAVEELWRPLATEVRRDALGNVIAVVRGEGLPLPEG
GRASVMWAAHMDEIALLVAAIEDEGFLRVDAAGGADPRNLLAQEVTVHTAGGPLAGVVGT
KPPHLTSAEEARQVPRLRDLFVDVGLPPEEVRRRVRVGDPITVRQSPARLQGQRMTGKSL
DNRVGVTVLTLALEELARRRHAVDVYAVATVQEEVGLRGATTSAYGLHPTLAIAVDVTFG
DQPGIPDGKTVEVGKGAAVAQGANVHPRVLEALREAARAEGIATQPEPIPGASGTDAWAI
QIAREGIPTGLVSVPLRHMHSPAEVVDLDDVREAARLLAAMAARLDAEAVTRLVGPGWQE
VRPGAAGAAQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ttggatgcggccgaggttctggcacgcctggccggcatcgccgggcccccgggccacgaa
gccccggtggcggcggcggtggaggaactctggcgcccgctggccacggaggtgcggcgg
gacgccctgggcaacgtgatcgccgtcgtccggggcgaggggctgcccctgccggagggc
gggcgggccagcgtgatgtgggcggcccacatggacgagatcgccctgctggtggccgcc
atcgaagacgagggtttcctgcgggtcgacgccgccggcggcgccgacccccgcaacctg
ctggcgcaggaggtgacggtccacaccgccggcgggcccctggccggcgtggtgggcacc
aagccgccccacctgaccagcgccgaagaggcgcggcaggtgccccgcctgcgggacctg
ttcgtcgacgtggggttgccgcccgaggaggtccggcgccgggtgcgggtgggcgacccc
atcaccgtgcgccagtccccggcccgcctccagggccagcgcatgacgggcaagagcctg
gacaaccgggtgggtgtcaccgtcctcaccctggcgctggaggaactggcccggcgccgg
cacgccgtggacgtctacgccgtggccacggtccaggaggaggtgggtctccggggcgcc
accaccagcgcctacggccttcacccgaccctggccattgcggtggacgtgaccttcggc
gaccagcccggcatccccgacggcaagaccgtcgaggtcggcaagggggcggccgtggcc
cagggagccaacgtgcacccgcgggtgctggaggccctgcgggaggccgcccgggccgag
ggcatcgccacccagcccgagcccatccctggcgcctcgggcaccgatgcgtgggccatc
cagatcgcccgggaggggatccccaccggcctggtctccgtgcccctgcgccacatgcat
agccccgccgaggtggtcgacctggacgacgtccgcgaggcagcccgcctgctggcggcc
atggcggcgcggctcgacgccgaggcggtgacccggctggtggggccgggctggcaggag
gtgaggcccggtgctgctggcgcggctcagtga

DBGET integrated database retrieval system