KEGG   Thermaerobacter marianensis: Tmar_1741Help
Entry
Tmar_1741         CDS       T01388                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmar_1741
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmar_1741
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tmar_1741
Enzymes [BR:tmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tmar_1741
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2087262..2088458)
Genome map
AA seq 398 aa AA seqDB search
MHQGEGSDEMNRRVPDVPRQGIIARYRDWLPVPPGAEPLTLGEGDTPLIRADRLLQELPP
DRRPPAVFLKFEGANPTGSFKDRGMTIALTCARARGARAVICASTGNTAAAAAAYAARAG
MDCWLVLPAGGVAAGKVGQAVACGARILPVRGSFDDALAAVRQVVAERPELVLVNSLNPD
RLEGQKTAAFEVADQLAALGLDEPAAVFLPVGNGGNITAYHMGFSAYAAAGRLRRMPRLY
GVQAEGAAPLVRGQPVDRPQTVASAIRIGRPVYGERALAAVRETGGRVLAVRDDEILAAQ
RLLARREGVFAEPASAASVAGLLKLAQGDEPGWEVPKGPVVCVLTGHGLKDVDTALRAAR
AGQGGPAPADLAALEAEALEPDAIVRHLLSVPVGGRSG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgcaccagggagaggggtcggacgagatgaaccgccgcgtcccagacgtcccgcgccag
ggcatcatcgcccgctaccgcgactggctcccggtaccgccgggagcggagccgcttacc
ctgggtgaaggcgacacgccgctgatccgggcggaccggctgctgcaggaactgcccccc
gaccggcggccgccggcggtgttcctcaagttcgagggggccaacccgacgggatccttc
aaggaccggggcatgaccatcgccctgacctgcgcccgggcccggggcgcccgggcggtg
atctgcgcttccacgggcaacacggcggcggctgcggccgcctacgcggcccgggcgggc
atggactgctggctggtgcttccggcggggggtgtggcggcgggcaaggtggggcaggcc
gtggcctgcggggcgcggatcctgcccgtgcggggcagcttcgacgacgccctggccgcg
gtgcggcaggtggtggccgagcggccggaactggtcctggtcaactccctcaaccctgac
cgcctcgagggccagaagacggccgccttcgaggtggcggaccagctggccgccctcggc
ctggacgaaccggcggccgtgttcctccccgtgggcaacggcggcaatatcaccgcctac
cacatggggttttccgcctacgcggcggccggacgcctccggcggatgccgcggctctac
ggggtccaggccgagggggcggcgcccctggtccgcggtcagcccgtcgaccggccgcag
acggtggcgtcggccatccgcatcggccggcccgtgtacggggagcgggccctggcggcg
gtgcgggagaccggcgggcgggtgctggcggtccgcgacgacgagatcctggcggcccag
cggctcctggcccggcgggaaggggtcttcgccgagccggcctcggcggcctccgtggcg
ggcctgctcaagctggcccaaggggacgaacccggctgggaggtgccgaaggggcccgtg
gtgtgcgtgctgacggggcacggtttgaaggacgtcgatacggccttgcgggctgcccgg
gcaggtcagggcgggccggcgccggcggacctcgctgcgctggaagccgaggccctcgaa
cccgacgccatcgtgcggcacttgctttcggtacccgtgggaggtcggtcgggatga

DBGET integrated database retrieval system