KEGG   Thermaerobacter marianensis: Tmar_1744Help
Entry
Tmar_1744         CDS       T01388                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00010  Glycolysis / Gluconeogenesis
tmr00620  Pyruvate metabolism
tmr00640  Propanoate metabolism
tmr00680  Methane metabolism
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
tmr01130  Biosynthesis of antibiotics
tmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_1744
   00620 Pyruvate metabolism
    Tmar_1744
   00640 Propanoate metabolism
    Tmar_1744
  Energy metabolism
   00680 Methane metabolism
    Tmar_1744
Enzymes [BR:tmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tmar_1744
Lipid biosynthesis proteins [BR:tmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tmar_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADU51848
JGI: Tmar_1744
UniProt: E6SHW8
Position
2090106..2092145
Genome map
AA seq 679 aa AA seqDB search
MPPAGRITFTGGCAVVDEGVEVAGPEPAAGALLAERPVPPRKLSGQPLLDGPNPAAYAAY
RARAEADADTYWAEMAGELEWMAPWTRVRTGDLPDFKYFVGGLTNVSLNCIDRHLRNGRR
NQAAIVWEGEPGDRRVWTYQMLHDETCRLAHALRRAGIGKGDVVAIYLPNLPETFAAIHA
CYRIGAVYNVIFSGFSPDAIRSRLEDSRARVVITADGSYRRGRFLPLKETLDQALEGLDF
VEKVVVVRRAGAEVPMTPGRDVFYDDFVAGMPADFPPEPLEANEPGFIIYTSGTTAKPKG
LVHAGVGFLVGTYANVKWSLNLQPDDIYWCTADVGWLTFPIFALVGGLAHGATHVVYEGA
LDYPHPGRFYQMIQRYRVNKVFTAPTALRMLSRAGAEWPRRYDLRSLELIALVGEPLDPE
TWHWVRRHVGDGAVEINNTYGQTETGTAWMSGIAGVTASRPGSCGLPLPGYRCQVVDAAG
RPVPPGTTGYLVITGPFPCLARTIWGDHPRYLDTYFSRFPGRYFTGDAAMYDADGHHWVL
GRVDDVINVAGHRLSTMEMESALINHPMVAEAAVVGMPDPVKGTVPVVFAVLRTGVTPPP
DIEEQLREEIARRISPIARPARVYVVDAMPKTRSGKIMRRLLREAVTTGQVTGDTTALED
PEVLERILARVEPMPGRTG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgccaccggccggccggatcaccttcacggggggatgcgcggtggtagacgaaggggtc
gaggtggcgggccccgagcccgccgccggggcgctgctggcggagcggccggttcctccg
cggaagctttccgggcaaccgctcttggacgggccgaacccggcggcctacgccgcctac
cgggcccgggccgaggccgatgccgatacctactgggcggagatggcgggcgagctggag
tggatggcgccctggacccgggtccgcacgggggacctgcctgacttcaagtacttcgtc
ggcgggctgaccaacgtgagcctcaactgcatcgaccgccacctccggaacggccggcgc
aaccaggcggcgatcgtctgggagggggagccgggcgaccgccgggtgtggacctaccag
atgcttcacgacgagacgtgccggctggcgcatgctcttcggcgggccgggatcggcaag
ggcgacgtggtggccatctacctccccaacctgcccgagaccttcgccgccatccacgcc
tgctaccgcatcggcgctgtttataacgtgatcttctcgggtttctcgcccgacgccatc
cgctcgcgcctggaagattcccgggcgcgggtggtgatcaccgccgacggcagctaccgc
cgcgggcggttcctcccgctgaaggagaccctggaccaggccctggaagggctcgacttc
gtcgaaaaggtggtggtcgtgcggcgggccggcgccgaggtccccatgacccctggccgc
gacgtgttctacgacgacttcgttgccggcatgccggccgatttcccgcccgagcccctg
gaggccaacgagcccgggttcatcatctacaccagcggcaccacggcgaagcccaagggc
ctggtccacgccggcgtgggcttcctggtcggcacctacgccaacgtcaagtggtcgctc
aacctgcagccggacgatatctactggtgcaccgccgacgtgggctggctgaccttcccc
atcttcgccctggtgggcgggctggcccacggcgccacccacgtggtgtacgagggggcc
ctggactacccccacccgggccggttctaccagatgatccagcggtaccgggtgaacaag
gtcttcacggcccccaccgccctgcggatgctgagccgggcgggggcggaatggccgcgc
cggtacgacctgcgcagcctggagctcatcgccctggtgggggagcccctggatcccgag
acctggcactgggtgcgccggcacgtgggtgacggcgcggtggagatcaacaacacctac
ggccagacggagacgggcacggcctggatgtcgggcatcgcgggcgtcaccgcctcgcgg
ccgggttcctgcgggctgcccttgcccggctaccgctgccaggtggtggacgccgcgggc
cggccggttcctccggggaccacgggctacctggtgatcaccggccccttcccgtgcctg
gcgcggaccatctggggcgaccatccgcggtacctggacacctacttctcccgcttcccc
ggccggtacttcaccggcgacgccgccatgtacgacgccgacggccaccactgggtcctg
ggccgcgtggacgacgtgatcaacgtggcggggcaccgcctgagcaccatggagatggag
agcgccctgatcaaccaccccatggtggcggaagcggcggtggtgggcatgccggatccc
gtcaagggcacggtgccggtggtgttcgccgtgctgcgcaccggggtgacgcccccgccc
gacatcgaggagcagttgcgggaggagatcgcccgccgcatcagccccatcgcccggcca
gcacgggtgtacgtggtcgacgccatgcccaagacccgcagcggcaagatcatgcggcgc
ctcttgcgggaggcggtgacgaccgggcaggtgacaggcgacaccaccgccttggaggat
ccggaggtgctcgagcggatcctggcgcgggtggaaccgatgccgggacgaaccggctga

DBGET integrated database retrieval system