KEGG   Thermaerobacter marianensis: Tmar_1744Help
Entry
Tmar_1744         CDS       T01388                                 

Definition
AMP-dependent synthetase and ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmar_1744
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_1744
   00620 Pyruvate metabolism
    Tmar_1744
   00640 Propanoate metabolism
    Tmar_1744
  Energy metabolism
   00680 Methane metabolism
    Tmar_1744
Enzymes [BR:tmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tmar_1744
Lipid biosynthesis proteins [BR:tmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tmar_1744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2090106..2092145
Genome map
AA seq 679 aa AA seqDB search
MPPAGRITFTGGCAVVDEGVEVAGPEPAAGALLAERPVPPRKLSGQPLLDGPNPAAYAAY
RARAEADADTYWAEMAGELEWMAPWTRVRTGDLPDFKYFVGGLTNVSLNCIDRHLRNGRR
NQAAIVWEGEPGDRRVWTYQMLHDETCRLAHALRRAGIGKGDVVAIYLPNLPETFAAIHA
CYRIGAVYNVIFSGFSPDAIRSRLEDSRARVVITADGSYRRGRFLPLKETLDQALEGLDF
VEKVVVVRRAGAEVPMTPGRDVFYDDFVAGMPADFPPEPLEANEPGFIIYTSGTTAKPKG
LVHAGVGFLVGTYANVKWSLNLQPDDIYWCTADVGWLTFPIFALVGGLAHGATHVVYEGA
LDYPHPGRFYQMIQRYRVNKVFTAPTALRMLSRAGAEWPRRYDLRSLELIALVGEPLDPE
TWHWVRRHVGDGAVEINNTYGQTETGTAWMSGIAGVTASRPGSCGLPLPGYRCQVVDAAG
RPVPPGTTGYLVITGPFPCLARTIWGDHPRYLDTYFSRFPGRYFTGDAAMYDADGHHWVL
GRVDDVINVAGHRLSTMEMESALINHPMVAEAAVVGMPDPVKGTVPVVFAVLRTGVTPPP
DIEEQLREEIARRISPIARPARVYVVDAMPKTRSGKIMRRLLREAVTTGQVTGDTTALED
PEVLERILARVEPMPGRTG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgccaccggccggccggatcaccttcacggggggatgcgcggtggtagacgaaggggtc
gaggtggcgggccccgagcccgccgccggggcgctgctggcggagcggccggttcctccg
cggaagctttccgggcaaccgctcttggacgggccgaacccggcggcctacgccgcctac
cgggcccgggccgaggccgatgccgatacctactgggcggagatggcgggcgagctggag
tggatggcgccctggacccgggtccgcacgggggacctgcctgacttcaagtacttcgtc
ggcgggctgaccaacgtgagcctcaactgcatcgaccgccacctccggaacggccggcgc
aaccaggcggcgatcgtctgggagggggagccgggcgaccgccgggtgtggacctaccag
atgcttcacgacgagacgtgccggctggcgcatgctcttcggcgggccgggatcggcaag
ggcgacgtggtggccatctacctccccaacctgcccgagaccttcgccgccatccacgcc
tgctaccgcatcggcgctgtttataacgtgatcttctcgggtttctcgcccgacgccatc
cgctcgcgcctggaagattcccgggcgcgggtggtgatcaccgccgacggcagctaccgc
cgcgggcggttcctcccgctgaaggagaccctggaccaggccctggaagggctcgacttc
gtcgaaaaggtggtggtcgtgcggcgggccggcgccgaggtccccatgacccctggccgc
gacgtgttctacgacgacttcgttgccggcatgccggccgatttcccgcccgagcccctg
gaggccaacgagcccgggttcatcatctacaccagcggcaccacggcgaagcccaagggc
ctggtccacgccggcgtgggcttcctggtcggcacctacgccaacgtcaagtggtcgctc
aacctgcagccggacgatatctactggtgcaccgccgacgtgggctggctgaccttcccc
atcttcgccctggtgggcgggctggcccacggcgccacccacgtggtgtacgagggggcc
ctggactacccccacccgggccggttctaccagatgatccagcggtaccgggtgaacaag
gtcttcacggcccccaccgccctgcggatgctgagccgggcgggggcggaatggccgcgc
cggtacgacctgcgcagcctggagctcatcgccctggtgggggagcccctggatcccgag
acctggcactgggtgcgccggcacgtgggtgacggcgcggtggagatcaacaacacctac
ggccagacggagacgggcacggcctggatgtcgggcatcgcgggcgtcaccgcctcgcgg
ccgggttcctgcgggctgcccttgcccggctaccgctgccaggtggtggacgccgcgggc
cggccggttcctccggggaccacgggctacctggtgatcaccggccccttcccgtgcctg
gcgcggaccatctggggcgaccatccgcggtacctggacacctacttctcccgcttcccc
ggccggtacttcaccggcgacgccgccatgtacgacgccgacggccaccactgggtcctg
ggccgcgtggacgacgtgatcaacgtggcggggcaccgcctgagcaccatggagatggag
agcgccctgatcaaccaccccatggtggcggaagcggcggtggtgggcatgccggatccc
gtcaagggcacggtgccggtggtgttcgccgtgctgcgcaccggggtgacgcccccgccc
gacatcgaggagcagttgcgggaggagatcgcccgccgcatcagccccatcgcccggcca
gcacgggtgtacgtggtcgacgccatgcccaagacccgcagcggcaagatcatgcggcgc
ctcttgcgggaggcggtgacgaccgggcaggtgacaggcgacaccaccgccttggaggat
ccggaggtgctcgagcggatcctggcgcgggtggaaccgatgccgggacgaaccggctga

DBGET integrated database retrieval system