KEGG   Thermaerobacter marianensis: Tmar_1780Help
Entry
Tmar_1780         CDS       T01388                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
tmr  Thermaerobacter marianensis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tmar_1780
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmar_1780
   00650 Butanoate metabolism
    Tmar_1780
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Tmar_1780
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tmar_1780
   00622 Xylene degradation
    Tmar_1780
   00621 Dioxin degradation
    Tmar_1780
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tmar_1780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2132131..2133063
Genome map
AA seq 310 aa AA seqDB search
MPGKGGRDGRVPVAILGSGNIGTDLMYKLLKRPGHMELVLVAGIDPQSEGLARARSLGLR
TSTRGIEAVLEAPEIRIVFDATSAKAHVRHAPRLERAGKIAIDLTPAARGPYVVPPVNLG
AHLDKPNVNLITCGGQATIPLVHAVARVTPVQYAEIVSTIASRSAGPGTRQNIDEFTYTT
ARGLEVIGGARHGKAIIILNPAEPPILMRNTVYVVPEADDIDEDAIRTSLESMVREVQEY
VPGYRLKPPVFDRRWTPWGEKPVVVLLLEVEGAGDFLPTYAGNLDIMTASAVRVGEVFAR
HLLGLREVVA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggaaagggaggccgggatgggcgggttcccgtggccatcctgggctcggggaac
atcggaacggacctcatgtataagcttctcaagcgaccggggcacatggagctggtcctc
gtagcggggatcgatccccagtccgaggggctggcccgtgcccgcagcctgggccttcgc
accagcacccgggggatcgaagccgtcctggaagccccggagatccgcatcgtcttcgac
gccaccagcgccaaggcccacgtgcgccatgctccccgtctggaacgggccggaaagatc
gccatcgacctgacgccggccgcccgcgggccctatgtggtcccgccggtgaacctgggt
gcccacctcgacaagcccaacgtcaacctcattacatgcggcggccaggcgaccatcccg
ctggtgcacgccgtggccagggtcacgccggtgcagtacgcggagatcgtcagcaccatc
gccagccgctcggcgggcccgggcacgcgccagaacattgacgagttcacctacaccacg
gcgagagggctggaggtgatcggcggggcgcgccacggcaaggccatcatcatcctgaac
cccgccgagccgcccatcctcatgcgcaacaccgtgtacgtcgtgcccgaggcggacgac
atcgacgaggacgcaatcaggacctccctggagtccatggtacgggaggtccaggagtac
gtcccgggctaccgcctgaagcccccggtcttcgaccggcggtggacgccgtggggcgag
aagcccgtggtcgtcctcctgctggaagtcgagggggccggtgatttcctgcccacctac
gccggcaacctggacatcatgacggcctcggccgtccgggtcggggaagtgttcgcccgg
caccttctgggattgcgggaggtggtcgcttga

DBGET integrated database retrieval system