KEGG   Thermaerobacter marianensis: Tmar_1804Help
Entry
Tmar_1804         CDS       T01388                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00010  Glycolysis / Gluconeogenesis
tmr00071  Fatty acid degradation
tmr00350  Tyrosine metabolism
tmr00625  Chloroalkane and chloroalkene degradation
tmr00626  Naphthalene degradation
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
tmr01130  Biosynthesis of antibiotics
tmr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_1804
  Lipid metabolism
   00071 Fatty acid degradation
    Tmar_1804
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tmar_1804
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tmar_1804
   00626 Naphthalene degradation
    Tmar_1804
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tmar_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C TrkA_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADU51905
JGI: Tmar_1804
UniProt: E6SI94
Position
complement(2158774..2159907)
Genome map
AA seq 377 aa AA seqDB search
MKTRAAILVEMGRPRPYTESHPVVVDEVDLDGPGYGEVLVELKAAGICHSDLSVVDGSRP
RPTPMVLGHEAAGIVRETGPGVTSLQPGDHVVFTFVPMCGRCMYCTGGRPALCELGNAAN
ARGELLRGGRRFHRHGQPVHHHLGVSAFSQFTVAAEESLIKIDPDVPFEVAAVFGCAVMT
GVGAVVNTARVEPGSSVAVFGLGGVGLAAVMGAVAAGAYPVVAVDVLPEKLEHARALGAT
HVVNAREADAVEAVRDLTGGGADYAIEAAGNADVLAQAYRATRRGGTTITVGLPHPEAAL
SIPAVTVTAEERVLRGSYMGSAVPRRDLPRFLRLFRAGRLPVDRLITHRIGLDEINQGFD
RLAAGEAVRQVVLPNAG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccagggccgccattctggtcgagatgggacgaccgcggccgtacaccgagtcc
cacccggtggtcgtggacgaggtggacttggacggcccgggatacggcgaggtgttggtc
gagctcaaggcagcggggatctgccattcggatctctccgtggtggacgggagccggccc
cggcccacgccgatggttctgggacacgaggcggcgggcatcgtccgggagaccggtccc
ggtgtgaccagtttgcagccgggcgaccacgtggtcttcaccttcgttcccatgtgcggg
cggtgcatgtactgcaccggcggcaggcccgccttgtgcgagctgggcaacgcagccaat
gctcgcggcgagctcctgcgaggtggacgccggttccaccgccacggccagcccgtgcac
caccacctgggggtgtcggccttctcgcagttcaccgtggcggccgaggagtcgctgatc
aagatcgatcccgacgtccccttcgaggtcgcggccgtgttcgggtgtgccgtgatgacg
ggtgtcggtgccgtggtgaacacggctcgggtggaacccggaagttccgtggcggtgttc
ggtcttgggggagtcgggctggccgccgtgatgggcgcggttgcggcaggggcgtacccc
gtggtggcggtcgacgtgctgccggagaagttggagcatgcccgcgccctgggtgcgacc
cacgtcgtgaacgcccgggaggccgacgcggtggaggcggtgcgggatctcacggggggc
ggtgccgattatgccatcgaggctgcgggcaacgccgacgttctcgcccaggcgtaccgg
gccacccggcgcggtggtacgaccatcaccgtcggcctgccccaccccgaggcggcgttg
tccatcccggcggtgacggttacggcggaggagcgggtcctccgtggctcgtacatgggt
tccgccgtaccccggcgggacttgccgcgtttcctccgcctgttccgggcgggccggctt
cccgtggaccggttgattacccatcgcatcggccttgacgaaatcaaccagggctttgat
cgcctggccgccggtgaagcggtgcggcaggtggtgctgcccaacgcgggctga

DBGET integrated database retrieval system