KEGG   Thermaerobacter marianensis: Tmar_1804Help
Entry
Tmar_1804         CDS       T01388                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tmar_1804
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_1804
  Lipid metabolism
   00071 Fatty acid degradation
    Tmar_1804
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tmar_1804
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tmar_1804
   00626 Naphthalene degradation
    Tmar_1804
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tmar_1804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2158774..2159907)
Genome map
AA seq 377 aa AA seqDB search
MKTRAAILVEMGRPRPYTESHPVVVDEVDLDGPGYGEVLVELKAAGICHSDLSVVDGSRP
RPTPMVLGHEAAGIVRETGPGVTSLQPGDHVVFTFVPMCGRCMYCTGGRPALCELGNAAN
ARGELLRGGRRFHRHGQPVHHHLGVSAFSQFTVAAEESLIKIDPDVPFEVAAVFGCAVMT
GVGAVVNTARVEPGSSVAVFGLGGVGLAAVMGAVAAGAYPVVAVDVLPEKLEHARALGAT
HVVNAREADAVEAVRDLTGGGADYAIEAAGNADVLAQAYRATRRGGTTITVGLPHPEAAL
SIPAVTVTAEERVLRGSYMGSAVPRRDLPRFLRLFRAGRLPVDRLITHRIGLDEINQGFD
RLAAGEAVRQVVLPNAG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaccagggccgccattctggtcgagatgggacgaccgcggccgtacaccgagtcc
cacccggtggtcgtggacgaggtggacttggacggcccgggatacggcgaggtgttggtc
gagctcaaggcagcggggatctgccattcggatctctccgtggtggacgggagccggccc
cggcccacgccgatggttctgggacacgaggcggcgggcatcgtccgggagaccggtccc
ggtgtgaccagtttgcagccgggcgaccacgtggtcttcaccttcgttcccatgtgcggg
cggtgcatgtactgcaccggcggcaggcccgccttgtgcgagctgggcaacgcagccaat
gctcgcggcgagctcctgcgaggtggacgccggttccaccgccacggccagcccgtgcac
caccacctgggggtgtcggccttctcgcagttcaccgtggcggccgaggagtcgctgatc
aagatcgatcccgacgtccccttcgaggtcgcggccgtgttcgggtgtgccgtgatgacg
ggtgtcggtgccgtggtgaacacggctcgggtggaacccggaagttccgtggcggtgttc
ggtcttgggggagtcgggctggccgccgtgatgggcgcggttgcggcaggggcgtacccc
gtggtggcggtcgacgtgctgccggagaagttggagcatgcccgcgccctgggtgcgacc
cacgtcgtgaacgcccgggaggccgacgcggtggaggcggtgcgggatctcacggggggc
ggtgccgattatgccatcgaggctgcgggcaacgccgacgttctcgcccaggcgtaccgg
gccacccggcgcggtggtacgaccatcaccgtcggcctgccccaccccgaggcggcgttg
tccatcccggcggtgacggttacggcggaggagcgggtcctccgtggctcgtacatgggt
tccgccgtaccccggcgggacttgccgcgtttcctccgcctgttccgggcgggccggctt
cccgtggaccggttgattacccatcgcatcggccttgacgaaatcaaccagggctttgat
cgcctggccgccggtgaagcggtgcggcaggtggtgctgcccaacgcgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system