KEGG   Thermaerobacter marianensis: Tmar_2099Help
Entry
Tmar_2099         CDS       T01388                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tmr  Thermaerobacter marianensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tmr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tmr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2532349..2533617
Genome map
AA seq 422 aa AA seqDB search
MSGRREGAESAGVPGRPAGRPIRVLVVDDSAFMRRVITRILESDPALEVVGTARDGLEAV
ARAAQLQPDVITLDVEMPRLDGLAALPQILAVHRCPVVMVSSLTQQGALATVRALALGAV
DFVAKPSGSVSLDLDRVAGELVGKVKAAAAVPPERVGLAAPSAPARPSGRTGLRSPDLAP
PPASADPATGDPAQAPAPVPAGGSLVPAGPAPVPRSSPGAGSRRITHLVLVAASTGGPGA
LYRLLGALPTGLPAAVVIVQHMPPGFTRALAAHLDDASGLTVTEAADGDRLHDGGAWVAP
GDYHVRVTPGGVLRLDRSPPRHGVRPAADVTFESVPPELAGRAIAIILTGMGADGARGAR
YLREHGARVWIQSPASCVVPGMPGAAAALGVVERAGTPEELAAWLVEAVGGPGLPADGRA
GG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtcggcgcgagggggccgaatccgccggcgtccccgggcgtccggccggccgg
cccatccgggtgctggtggtcgacgactccgccttcatgcgccgggtgatcacccgcatc
ctggagtccgatcctgcgctcgaggtggtgggaaccgcccgggacgggcttgaggccgtg
gcccgggccgctcagctgcagcccgacgtgatcaccctggacgtggagatgccgcgcctg
gacggcctggccgccctgccgcagatcctggcggtgcaccgctgcccggtggtcatggtc
tccagcctgacccagcagggggccctggcgaccgtccgggccctggccctgggggcggtg
gacttcgtcgccaagccgtcgggctccgtctccctggatctggaccgggtggcgggagaa
ctggtggggaaggtcaaggccgccgctgccgtcccgccggagcgggtgggcctggccgcc
ccgtccgctccggcccgtccatccggtcgaaccggcctgcggtcgccggacctggctccc
cctcccgcatccgcggatccggcgacgggggatcccgcccaagccccggcgccggtcccg
gccggtggcagcctggtaccggccggcccggccccggtgccgcgttcttcccccggggcc
ggatcccgccggatcacccacctggtcctggtggccgcctcgacgggcggtcccggcgct
ttgtaccggctgctgggcgcgctgcccaccggcctgccggcggcggtggtcatcgtgcag
cacatgccgcccggcttcacccgggccctggccgcccacctcgacgacgccagcggcctg
acggtgaccgaggcggccgacggcgaccgccttcacgacggcggcgcctgggtagccccc
ggcgactaccatgtgcgggtgacgccgggcggcgtcctgcgcctcgaccgcagcccgccc
cgccacggcgtccggcccgccgccgacgtgaccttcgaatcggtaccacccgagctggcc
gggcgggccatcgccatcatcctgacggggatgggggcggacggcgcccggggggcccgc
tacctgcgggagcacggggcccgggtgtggattcagtccccggccagctgcgtggttccc
ggcatgcccggggccgctgccgccctgggcgtggtggaacgggccggcacgccggaggaa
ctggccgcctggctggtcgaggccgtgggcgggccgggtctcccggcggatggcagggcc
ggcgggtaa

DBGET integrated database retrieval system