KEGG   Thermaerobacter marianensis: Tmar_2099Help
Entry
Tmar_2099         CDS       T01388                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tmr  Thermaerobacter marianensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tmar_2099
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Tmar_2099
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Tmar_2099
Two-component system [BR:tmr02022]
 CheA family
  CheA-CheYBV
   Tmar_2099
Bacterial motility proteins [BR:tmr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Tmar_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2532349..2533617
Genome map
AA seq 422 aa AA seqDB search
MSGRREGAESAGVPGRPAGRPIRVLVVDDSAFMRRVITRILESDPALEVVGTARDGLEAV
ARAAQLQPDVITLDVEMPRLDGLAALPQILAVHRCPVVMVSSLTQQGALATVRALALGAV
DFVAKPSGSVSLDLDRVAGELVGKVKAAAAVPPERVGLAAPSAPARPSGRTGLRSPDLAP
PPASADPATGDPAQAPAPVPAGGSLVPAGPAPVPRSSPGAGSRRITHLVLVAASTGGPGA
LYRLLGALPTGLPAAVVIVQHMPPGFTRALAAHLDDASGLTVTEAADGDRLHDGGAWVAP
GDYHVRVTPGGVLRLDRSPPRHGVRPAADVTFESVPPELAGRAIAIILTGMGADGARGAR
YLREHGARVWIQSPASCVVPGMPGAAAALGVVERAGTPEELAAWLVEAVGGPGLPADGRA
GG
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtcggcgcgagggggccgaatccgccggcgtccccgggcgtccggccggccgg
cccatccgggtgctggtggtcgacgactccgccttcatgcgccgggtgatcacccgcatc
ctggagtccgatcctgcgctcgaggtggtgggaaccgcccgggacgggcttgaggccgtg
gcccgggccgctcagctgcagcccgacgtgatcaccctggacgtggagatgccgcgcctg
gacggcctggccgccctgccgcagatcctggcggtgcaccgctgcccggtggtcatggtc
tccagcctgacccagcagggggccctggcgaccgtccgggccctggccctgggggcggtg
gacttcgtcgccaagccgtcgggctccgtctccctggatctggaccgggtggcgggagaa
ctggtggggaaggtcaaggccgccgctgccgtcccgccggagcgggtgggcctggccgcc
ccgtccgctccggcccgtccatccggtcgaaccggcctgcggtcgccggacctggctccc
cctcccgcatccgcggatccggcgacgggggatcccgcccaagccccggcgccggtcccg
gccggtggcagcctggtaccggccggcccggccccggtgccgcgttcttcccccggggcc
ggatcccgccggatcacccacctggtcctggtggccgcctcgacgggcggtcccggcgct
ttgtaccggctgctgggcgcgctgcccaccggcctgccggcggcggtggtcatcgtgcag
cacatgccgcccggcttcacccgggccctggccgcccacctcgacgacgccagcggcctg
acggtgaccgaggcggccgacggcgaccgccttcacgacggcggcgcctgggtagccccc
ggcgactaccatgtgcgggtgacgccgggcggcgtcctgcgcctcgaccgcagcccgccc
cgccacggcgtccggcccgccgccgacgtgaccttcgaatcggtaccacccgagctggcc
gggcgggccatcgccatcatcctgacggggatgggggcggacggcgcccggggggcccgc
tacctgcgggagcacggggcccgggtgtggattcagtccccggccagctgcgtggttccc
ggcatgcccggggccgctgccgccctgggcgtggtggaacgggccggcacgccggaggaa
ctggccgcctggctggtcgaggccgtgggcgggccgggtctcccggcggatggcagggcc
ggcgggtaa

DBGET integrated database retrieval system