KEGG   Thermaerobacter marianensis: Tmar_2126Help
Entry
Tmar_2126         CDS       T01388                                 

Definition
alcohol dehydrogenase GroES domain protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tmar_2126
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_2126
  Lipid metabolism
   00071 Fatty acid degradation
    Tmar_2126
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tmar_2126
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tmar_2126
   00626 Naphthalene degradation
    Tmar_2126
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tmar_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2563401..2564681)
Genome map
AA seq 426 aa AA seqDB search
MKAWQLHGPADAGSQPLRLAEVPEPEPGPGEIRLRVRACGVCLTDVHTVEGDLVPPSYPV
IPGHQVVGVVDAVGPGVAGVRVGERRGAFWLHRACGRCPACRRGEENLCPHAAFTGLHVP
GGYAEAMVVPAASTVPIPQAFTDAEAAPLLCAGVIGYRALRLSGLQPGERLALFGFGSSA
HLVIQVARHRGCEVVVFTRSPGHRRLALELGAAWAGSAEVLAADEPAAGKARPTGTAGDG
WPPAGPEGGAGASGVVPRAAGTAPTSAGEARTAAGKTGTARVKSAGPGGAGGGIDTGKPL
SLEGSDPAAGGRPPLCDRAIVFAPAGELVPLALRAVRPGGTVVINAVHMTDIPSFPYRLI
HGERVVRTVAHVTRRDAREFMEVAAAIPLRVAVRPYGFDQANQALYDVKHSRVDGSAVLA
MPSAQA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctggcagctgcacggacctgcagacgccggctcgcagcccctgcgcctcgcg
gaggttcccgagccggagccggggccgggcgagatccggctgcgggtccgggcctgcggc
gtgtgcctgaccgatgtccacacggtcgaaggcgacctggtgccgccgtcctatccggtg
atcccgggccatcaggtggtcggcgtggtggacgccgtcggtcccggcgtggcaggggtt
cgggtcggggagcggcgtggtgccttctggctgcaccgcgcgtgcggccgctgcccggcc
tgccggcgcggagaggagaacctgtgcccgcacgcggcttttaccggcctgcacgttccg
ggcgggtacgccgaggcgatggtcgtccctgccgcctccaccgtgcccattccccaggcc
ttcaccgatgccgaggcggcgccgctgctctgcgcgggcgtcatcggctaccgcgccctg
cgcttgagcgggctgcagccgggcgagcggctggccctgttcggattcggctcgtccgcc
cacctggtgatccaggtcgcccggcaccggggttgtgaggtggtggtgttcacccgcagt
cctggacaccgccgcctggccttggagctgggcgcggcctgggccggaagcgcggaggtg
ctggccgcagacgaaccggccgccgggaaggcacgccccacgggcacggcgggagatggt
tggcctccggcgggcccggaagggggcgccggcgcctcgggggtggttcccagggccgcc
gggacggcgcccacgtccgccggtgaggcgcgcaccgcggcgggcaagaccggtacggcg
cgggtcaagagcgccgggcccggcggggcgggcggcgggattgacactggaaaacccctc
agccttgagggctcggatccggcggcgggtggccggccgcccttgtgcgaccgggccatc
gtcttcgctcccgccggggagctggttccgctggcattgcgagccgtgcggccgggagga
accgtggtcatcaatgcggttcacatgaccgacatcccttcctttccataccggctgatc
cacggcgagcgggtcgtgcgcaccgtggcccacgtgacccgccgcgatgcccgggagttc
atggaggtggcggccgctatccccctgcgggtggcggtgcgcccgtacgggttcgatcaa
gcaaaccaggcgttgtacgacgtcaagcacagccgggtcgacgggtcggcggtcctggcg
atgccttctgcccaagcatga

DBGET integrated database retrieval system