KEGG   Thermaerobacter marianensis: Tmar_2241Help
Entry
Tmar_2241         CDS       T01388                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00010  Glycolysis / Gluconeogenesis
tmr00051  Fructose and mannose metabolism
tmr00562  Inositol phosphate metabolism
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
tmr01130  Biosynthesis of antibiotics
tmr01200  Carbon metabolism
tmr01230  Biosynthesis of amino acids
Module
tmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tmr_M00002  Glycolysis, core module involving three-carbon compounds
tmr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_2241
   00051 Fructose and mannose metabolism
    Tmar_2241
   00562 Inositol phosphate metabolism
    Tmar_2241
Enzymes [BR:tmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tmar_2241
Exosome [BR:tmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tmar_2241
  Exosomal proteins of bladder cancer cells
   Tmar_2241
  Exosomal proteins of melanoma cells
   Tmar_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU52319
JGI: Tmar_2241
UniProt: E6SKU6
Position
complement(2707033..2707977)
Genome map
AA seq 314 aa AA seqDB search
MTPAAPGAPAVQRRPLFAGNWKMHTLPAEAARLAAAVREGLDGWGGGDPAAAGGTVTPGV
AGRGAGTQPAEGPAGPPAAGAAEVVLCPPFTSLAAAAEALAGSAIALGAQDLAWGDFGAF
TGEVSAPMLRELGCRYVIVGHSERRQLLGETDALILRKLEAALAGGLVPILCVGEDAAQR
REGRTAAVVLGQAAHALAGLDGEQAARVVIAYEPVWAIGSGTPATPADAQAVAAALRGLI
ERLHGPAVAAAVRILYGGSVKPDNIGGFMAQPDIDGALVGGASLDGAGFARLVRQGVAAR
AAAPGGAAAGEERS
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgcggcgcctggggcgccggcggtccagcgccggcccctgtttgccggcaac
tggaagatgcacaccctgccggccgaagcggcccggctggcggcggcggtgcgggaaggt
cttgacggttggggtggcggcgatcccgccgcagcgggcgggacggtgacgcccggggtc
gccggcaggggggccgggacgcagccggcggagggacccgcggggccgcccgcggcgggg
gcggccgaggtcgtcctctgcccgcccttcacctccctggccgctgcggcggaggccctg
gccggcagcgccatcgccctgggcgcccaggacctggcctggggcgacttcggcgccttc
accggcgaggtctcggcgcccatgctgcgcgagctgggctgccggtacgtcatcgtcgga
cattcggagcggcgccagcttctgggcgagaccgatgccctgatcctgcgcaagctcgag
gccgccctggccggggggctggtccccatcctctgcgtcggcgaggatgccgcccagcgc
cgggaaggccggaccgcggcggtggtgctgggccaggcggcccatgccctggcggggctg
gacggggagcaggccgcccgggtggtcatcgcctacgagcccgtgtgggccatcggcagc
ggcaccccggccacgcccgccgacgcccaggcggtggcggcggcgctgcgcgggctgatc
gagcggcttcacggcccggcggtggcggcggcggtgcgcatcctctacggcggcagcgtc
aaacccgacaacatcggcggcttcatggcccagccggacatcgacggcgccctggtgggc
ggcgcctccctggacggcgcggggttcgcccggctggtccgtcagggggtggcggcccgg
gccgctgccccgggcggcgccgcagcgggggaggaacggtcatga

DBGET integrated database retrieval system