KEGG   Tremella mesenterica: TREMEDRAFT_30374Help
Entry
TREMEDRAFT_30374  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tms  Tremella mesenterica
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tms00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TREMEDRAFT_30374
Enzymes [BR:tms01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     TREMEDRAFT_30374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
Unknown
AA seq 277 aa AA seqDB search
MECRNQNHLLTSARPSEPEPHPVLSPTEWRPFTLTDKIALSHNTARYVFSLPKSTDCLGL
PIGQHISVSAEIDGKEIMRSYTPVTLDDDLGHFDLVVKTYDKGNISRYLSLLTIGQQVRI
KGPRGKFAYTRNLAPHLLMIAGGTGITPMYQIIKSSLKDPKDKTELALIYANVNEDDILL
RDDLEKMRDESNGRFKLYHTLNHPPAGWNQGTGFVTKEMIEQFMPKGGVGSSVHGEGEKV
LMCGPPPMIGAMKAHLAAIGYPAPRTISKLEDQVFCF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtcgaaaccaaaatcatcttctgacttcagctcgtccttcagaaccagaacct
catcccgtactctcacctacggaatggcgtcccttcactctgaccgacaaaatagctttg
tcacataatacagctcgatacgtcttttcactccctaaatctaccgattgtctaggatta
ccgatcggacaacatattagcgtgtcggctgaaattgatggcaaggaaattatgagaagt
tatacgcctgtaactttggatgatgatttgggtcatttcgatttggtcgtcaagacatac
gataaagggaatatttctagatatttatctcttctcactataggtcaacaagttaggatc
aaaggtccgaggggaaaattcgcttatactcgtaacctcgcccctcacctactcatgatc
gccggaggtacaggtatcacacccatgtatcagataatcaaatcttctttgaaagatcca
aaagacaaaactgagcttgctctcatatacgccaatgtcaatgaagatgatatcttgttg
agagatgatcttgagaaaatgagagatgaatccaatggaagattcaagctctaccatacc
ctgaaccatcccccagctggctggaatcaaggtactggcttcgttacgaaagaaatgatt
gaacaattcatgcctaaaggtggcgtcggatcttctgttcatggagaaggggaaaaggtg
ttgatgtgtggaccccctcctatgatcggagcgatgaaagcccatctggccgccataggt
tatcccgccccacgaaccatctccaagctagaagatcaagtcttctgcttttga

DBGET integrated database retrieval system