KEGG   Thermoanaerobacter mathranii: Tmath_0002Help
Entry
Tmath_0002        CDS       T01250                                 

Definition
DNA polymerase III subunit beta (EC:2.7.7.7)
Orthology
K02338  
DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tmt00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tmt00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:tmt03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tmt03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tmt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1667..2779
Genome map
AA seq 370 aa AA seqDB search
MKFVCDKNSLFEGVNIAIRGVSSRTTLPILQGIKITALKDQVKFSGTDLDIGIECQIPAM
VEEEGEIVVPAKIFSELVRKLPEEDVKIESDSQNTVNVICDSINFTIAGSDAVEFPEIPQ
VSKENSFKLTKNILKDLIKKTVFCIAHEQTRPILTGVLFEVFPNEIKAVALDGFRMAIYT
YQSEEKFFEEGIEKYSIVIPGKTLEEIYKILEDEETEIDIYHTANQVLFQIENTKVISRL
LEGSFINYNAVLPKDYKTEVVVKREVLTESIERASLIAESKNNLIKFEIGDKFITVSSNS
EKGKMVEKIEVNVKGMFLEIAFNSRYLLDSLRAIDEEEITLYFINSINPLIIKPIGSKDY
LYMILPVKLN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgtgtgtgacaaaaattcattatttgaaggagtaaatattgcaataaggggg
gtatcctcccgtaccacacttcccattctccaaggaataaaaatcacagctttaaaagat
caagttaaattttcaggaaccgacctggatataggaatagaatgccaaattcctgccatg
gtagaagaagaaggggaaatagtagtacctgcaaaaattttctcagaattagtccgaaaa
ttgcctgaagaggatgtaaaaatagaaagtgattctcaaaatacagtaaatgtgatctgc
gatagtataaatttcactattgcaggaagtgatgctgtagagtttcccgaaattcctcaa
gtatcaaaggaaaactcttttaaattgaccaaaaatattctgaaggatttaataaaaaag
acagtcttttgcattgcccacgagcaaacaagaccgattttgacaggtgttttatttgaa
gtatttccaaatgaaataaaagcagtggctttagatggattcagaatggccatatacact
tatcaaagtgaggaaaaattttttgaagaaggtatagagaaatattctatagtaattcca
ggtaaaactttggaagagatatataaaatcttagaagatgaggaaacagaaatagatata
taccatactgctaatcaagtgctattccaaattgaaaatacaaaggtaatatcaaggctt
ttagaaggaagctttataaactacaatgctgttctgccaaaggattataagactgaagtg
gtagttaaaagggaagttttaactgaaagtattgaaagagcttcactaattgcagaaagc
aaaaataatttgattaagttcgaaataggtgataaatttattactgtctcttccaattct
gaaaagggaaagatggtagaaaagatagaagttaatgtaaaaggaatgtttcttgagatt
gcttttaattccagatatttactagactctttaagagccatcgatgaagaagaaataacg
ctctatttcataaatagtataaatccgttaataataaaacctataggaagcaaagattat
ctttatatgatacttcctgtaaagctcaattaa

DBGET integrated database retrieval system