KEGG   Thermoanaerobacter mathranii: Tmath_0002Help
Entry
Tmath_0002        CDS       T01250                                 

Definition
DNA polymerase III subunit beta (EC:2.7.7.7)
Orthology
K02338  
DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tmath_0002
   00240 Pyrimidine metabolism
    Tmath_0002
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tmath_0002
   03430 Mismatch repair
    Tmath_0002
   03440 Homologous recombination
    Tmath_0002
Enzymes [BR:tmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Tmath_0002
DNA replication proteins [BR:tmt03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Tmath_0002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1667..2779
Genome map
AA seq 370 aa AA seqDB search
MKFVCDKNSLFEGVNIAIRGVSSRTTLPILQGIKITALKDQVKFSGTDLDIGIECQIPAM
VEEEGEIVVPAKIFSELVRKLPEEDVKIESDSQNTVNVICDSINFTIAGSDAVEFPEIPQ
VSKENSFKLTKNILKDLIKKTVFCIAHEQTRPILTGVLFEVFPNEIKAVALDGFRMAIYT
YQSEEKFFEEGIEKYSIVIPGKTLEEIYKILEDEETEIDIYHTANQVLFQIENTKVISRL
LEGSFINYNAVLPKDYKTEVVVKREVLTESIERASLIAESKNNLIKFEIGDKFITVSSNS
EKGKMVEKIEVNVKGMFLEIAFNSRYLLDSLRAIDEEEITLYFINSINPLIIKPIGSKDY
LYMILPVKLN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgtgtgtgacaaaaattcattatttgaaggagtaaatattgcaataaggggg
gtatcctcccgtaccacacttcccattctccaaggaataaaaatcacagctttaaaagat
caagttaaattttcaggaaccgacctggatataggaatagaatgccaaattcctgccatg
gtagaagaagaaggggaaatagtagtacctgcaaaaattttctcagaattagtccgaaaa
ttgcctgaagaggatgtaaaaatagaaagtgattctcaaaatacagtaaatgtgatctgc
gatagtataaatttcactattgcaggaagtgatgctgtagagtttcccgaaattcctcaa
gtatcaaaggaaaactcttttaaattgaccaaaaatattctgaaggatttaataaaaaag
acagtcttttgcattgcccacgagcaaacaagaccgattttgacaggtgttttatttgaa
gtatttccaaatgaaataaaagcagtggctttagatggattcagaatggccatatacact
tatcaaagtgaggaaaaattttttgaagaaggtatagagaaatattctatagtaattcca
ggtaaaactttggaagagatatataaaatcttagaagatgaggaaacagaaatagatata
taccatactgctaatcaagtgctattccaaattgaaaatacaaaggtaatatcaaggctt
ttagaaggaagctttataaactacaatgctgttctgccaaaggattataagactgaagtg
gtagttaaaagggaagttttaactgaaagtattgaaagagcttcactaattgcagaaagc
aaaaataatttgattaagttcgaaataggtgataaatttattactgtctcttccaattct
gaaaagggaaagatggtagaaaagatagaagttaatgtaaaaggaatgtttcttgagatt
gcttttaattccagatatttactagactctttaagagccatcgatgaagaagaaataacg
ctctatttcataaatagtataaatccgttaataataaaacctataggaagcaaagattat
ctttatatgatacttcctgtaaagctcaattaa

DBGET integrated database retrieval system