KEGG   Thermoanaerobacter mathranii: Tmath_0247Help
Entry
Tmath_0247        CDS       T01250                                 

Definition
Endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tmt  Thermoanaerobacter mathranii
Brite
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Tmath_0247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
257019..258044
Genome map
AA seq 341 aa AA seqDB search
MFIENKNGINGTISLKEVYKDYFLIGAAVEVEDLEDGLHRQLLLKHFNSLTAENAMKFER
IHPKEDEFNFKDADKIVEFAMENNLKVRGHTFVWHNQTPEWVFKDKTGNEVSKELLLERL
KFHINTVCNHYKNKIYAWDVVNEAIEDKEDYVLRKSPWYRIIGKEYVELAFKFVREADPE
VELYYNDYNNEKPYKLYKTYDFLKSLLDKGIPIDGIGIQGHWDIYDEGLFDNLKRAIELY
ASLGLKIQITELDISMFEFENKTREVLIPTAEMLELQALTYKKLFEIFRSYKGIITSVTF
WGISDKHTWKDNFPVKGRKDWPLLFDEKQNPKKAFFEIVDF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgtttatagaaaataaaaatggtattaatggtactataagcttaaaagaagtctataaa
gactattttcttataggagcagctgttgaagtcgaggatctggaagatggtttgcatagg
caattacttttaaaacattttaatagcttaactgcagaaaacgcgatgaagtttgagaga
attcatcctaaagaagatgaatttaattttaaagatgcggataaaattgttgaatttgca
atggaaaacaatttgaaagtaagaggtcatacttttgtgtggcataaccagactcctgaa
tgggtatttaaagataaaacaggaaatgaagtgtcaaaagaattattattagaaaggcta
aaatttcacataaatacagtttgcaatcactacaaaaacaaaatatatgcatgggacgta
gtaaatgaagctatagaagataaagaagattatgtactgagaaaatctccatggtataga
attattggcaaagagtatgttgagttagcctttaagtttgttagagaagctgaccctgag
gtcgaactttattataatgactataacaatgaaaaaccctataaactttacaaaacctat
gacttcttaaaatctctattagataaaggtatacctattgatggtattggcattcaaggc
cattgggatatttatgatgaaggattgtttgacaatcttaaaagagcgattgagctatat
gcgtctttaggactaaaaattcaaataacagaacttgacatatctatgtttgaatttgaa
aataagacacgcgaagttctaattcctacagcggaaatgttagaacttcaggccttgaca
tataaaaaactttttgaaattttcaggtcgtataaaggtataattacaagtgttactttt
tggggaattagtgataaacatacttggaaagataattttccggtgaagggtagaaaggat
tggcctttactttttgatgaaaaacaaaatcctaagaaagctttttttgaaatagtagat
ttttaa

DBGET integrated database retrieval system