KEGG   Thermoanaerobacter mathranii: Tmath_0261Help
Entry
Tmath_0261        CDS       T01250                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tmath_0261
Enzymes [BR:tmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tmath_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ADH60043
JGI: Tmath_0261
UniProt: D7ARD4
Position
278059..278988
Genome map
AA seq 309 aa AA seqDB search
MEKIVVVGSINMDVVIRVPHIPVVGETVIAYDLKNYGGGKGANQAVSIARLGGTVFMIGR
VGNDEYGKKLYEGLKIDSIDVKGIEFDYEIPTGTAYINVSERGENNIVVYQGANKRLNIE
QIEKHEDIFDEAKMCVIQLEIPVETVEFVVDLCYRKGIKVILNPAPACKLPDTLLEKVYI
LTPNETELAFLSKSKIETIADIKKASKYLLDKGVQNVITTIGEKGSFFINKDTEKLFDAI
KVTAVDTTAAGDSFTGALAVALSEGKNIESAIEFATYVAALTVTKEGAQSSLPYRDEVEK
FIKERSYNK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggagaagatagttgttgttggaagtattaatatggacgttgtgatacgagttccgcat
attcctgtagttggtgagacagttattgcttatgatttgaaaaattacggcggcggtaaa
ggcgcaaatcaagcggtatcaattgcaaggttgggtggaacggtctttatgatcggcaga
gtgggaaatgatgaatatggtaagaaattatatgagggcttaaaaattgatagcatagat
gttaaagggatagaatttgattacgaaataccgacgggtacagcttatattaatgtgagt
gaaagaggagaaaacaacatagttgtttatcagggagcaaataaaaggcttaatatagag
caaatagaaaaacacgaagatatttttgatgaagcaaaaatgtgtgtaattcagttagaa
ataccagttgagacagtagaatttgtagtggatttatgttaccggaaaggtataaaagtc
atattaaatcctgcaccagcatgtaaattgcctgatacgctcttagaaaaagtttacatt
ttaactcccaatgaaacagaactggcttttttatccaaaagtaaaatagaaacaattgca
gatataaaaaaggcctcaaaatatttgttggacaaaggggttcaaaacgttataacaact
attggagaaaaaggaagcttttttatcaataaggatacagaaaaactatttgatgcgatc
aaagttactgctgttgatacaacagcagcgggtgattcatttacaggagcattagcagtg
gcattaagtgaagggaagaacattgaaagtgcaatagaatttgctacatacgtagcagca
ttaacggttactaaagaaggtgctcagtcatccttgccttatagagatgaggtagaaaaa
tttattaaagaaaggagttataacaaatga

DBGET integrated database retrieval system