KEGG   Thermoanaerobacter mathranii: Tmath_0275Help
Entry
Tmath_0275        CDS       T01250                                 

Definition
(GenBank) glycoside hydrolase family 3 domain protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00520  Amino sugar and nucleotide sugar metabolism
tmt01100  Metabolic pathways
tmt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tmath_0275
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Tmath_0275
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tmath_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C VirC1 TK
Motif
Other DBs
NCBI-ProteinID: ADH60057
JGI: Tmath_0275
UniProt: D7ARE8
Position
292238..293818
Genome map
AA seq 526 aa AA seqDB search
MKKIEEMTLEEKIGQMLMIGFPSTFYDDHIRELVTSYKIRNVILFSRNVQDARQVMDLCT
DIQKETIENTGIPAFISIDQEGGMVTRIYRGATYLPGNMAIGATKDPENAYKVGEIAGRE
LRTIGININFAPVMDVNNNPLNPVIGVRSYGENPEDVANFGINYIKGLQKEGVIATAKHF
PGHGDTTVDSHLDLPKVSHGKGRLYEVELYPFLKAIENGVDAIMTAHILFPALEDSKVPA
TLSYNILTRILREEFKFDGLIITDCMEMNAIAKYFGTRKAASMAIKAGADIVLVSHTKDL
QIKAFENIKEAVERGEIPVERIDKSVRRILKMKEKYGLFDNPYPEKDKFDTTAEIEKHRK
IAKAISLKSITVVKDEKKLIPLKTKNVLAISPETVPASFVDDALMDRLSFARQFTSTFGG
VEETISVNPNDREISVILEKAKDKEVVVVGTYNANLNEGQVKLVNTLLQVNKDVIVVALR
NPYDLQKFENVPTYVCAYEYTPLSVESVIGVLTGKYPAEGKLPVTI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagaagaaatgacattagaagaaaaaatagggcaaatgctgatgataggc
tttccgtcaactttttacgacgaccatataagagaattagtaacaagttataaaataagg
aatgtaatactcttttcaagaaatgtgcaggatgcaaggcaagtaatggatttatgcact
gacatacagaaagaaacaatagaaaataccggaataccagcttttatctctattgaccag
gaaggtggaatggtcacaaggatttacagaggagctacttatcttcccggcaatatggct
attggtgctacaaaagacccagaaaatgcttataaagtgggagaaatagctggaagagaa
ttaagaactataggcataaacataaatttcgctccggttatggatgtgaacaacaaccct
ttaaatccagtgataggagtcaggtcttacggtgaaaacccagaggatgtggctaatttt
ggaataaactacataaaagggcttcaaaaagaaggtgtgatagctacagctaaacatttc
ccaggacatggagacacaactgtggattctcaccttgatttaccgaaagtcagtcatggc
aagggtaggctttatgaagtggaattatacccgtttttaaaagctatagaaaatggcgtg
gatgcgataatgacagctcatatacttttcccggctttagaagatagtaaagttcctgca
actctttcttataatatccttacccgcatcttaagggaagaattcaagtttgatgggtta
attataactgactgtatggaaatgaatgcgatagccaaatattttggcactcgaaaggcg
gcgtcaatggctataaaagctggagcagatatagtacttgtttctcatactaaagatcta
cagataaaagcttttgaaaatataaaagaagctgtagaaagaggagagatacctgtagaa
agaatagataaatcagtaagaaggatactcaagatgaaagaaaaatatggactttttgac
aatccatatcctgagaaagacaaatttgacaccacagctgaaattgagaaacataggaaa
attgcaaaagccataagtttaaagagcataacagttgttaaagatgagaaaaaattaatc
cctttaaagacgaaaaatgtactggcaatttctcctgaaacagttccggcttcttttgta
gacgatgctttgatggataggctttcttttgcaagacaatttacttctacatttggaggt
gtagaggaaactatttctgtaaatccaaacgatagagagatttcagtaattctagaaaag
gcaaaggataaagaagtagttgtcgtgggcacttacaatgctaatttaaacgaaggtcaa
gtaaaactagtaaacacacttttgcaagtgaacaaagatgtaattgttgtggctttgaga
aatccctatgacctccaaaagtttgaaaatgtgcctacttatgtatgtgcttacgagtac
accccattgtcagtagaaagcgtgataggagtcttgacggggaaatatcctgctgaagga
aaacttcctgtgaccatatga

DBGET integrated database retrieval system