KEGG   Thermoanaerobacter mathranii: Tmath_0374Help
Entry
Tmath_0374        CDS       T01250                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmath_0374
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Tmath_0374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
406136..407530
Genome map
AA seq 464 aa AA seqDB search
MAKEYKFPEGFWWGSATSAVQIEGAANEDGKGMNVWDYWYKNEPNRFFDRVGPQVTSDFY
HRYKDDIKLMKELGHNSFRFSISWSRLIPGGVGEVNKKAVEFYNSVIDELIKNDIEPFVT
LFHFDMPIEMQNMGGFENRKVVEYFAEYAKTCFELFGDRVKRWITFNEPIVPVLGGYLYN
FHYPDIVDFKRAVQFAYGTVLASARAIEEFKKLQIERAKIGIVLNLSPVYPRSNHPADLK
AAEIADLFYNRSFLDPTVKGEYPKELVELLKTYNHLPEYSDSDLELIKNNTVEYLGVNYY
QPIRVKAKENMPNPYGVFTPNWFYDEYIMPGRRMNPYRGWEIYERGIYDIMINLRDNYGN
IGSFISENGMGVEGEERFIKDGIIQDDYRIEFIKEHLKWLHKAIEEGCNVKGYHLWTFMD
NWSFLNAYKNRYGLVSVDLKTQKRTIKKSGYWYKELSENNGFVD
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaatacaaatttcctgaaggattctggtgggggtctgcaacgtcagcagta
caaatagagggagctgcaaatgaagatggaaagggaatgaatgtatgggattattggtac
aaaaacgagccaaatcgctttttcgatagagtaggccctcaagtaacatctgatttttac
cacagatataaagacgatataaaactgatgaaagaacttggacataactcttttagattt
tctatttcatggtcgcggctgatacctggtggtgttggtgaagtcaataaaaaagccgta
gagttttataacagtgtcattgatgagcttataaaaaatgatatagaaccgtttgttacg
ctatttcactttgacatgcctatagaaatgcaaaacatgggaggttttgagaatagaaaa
gtagtagaatattttgctgaatatgccaaaacatgctttgagttgtttggagatagagtc
aaaagatggattacatttaatgaaccaatagttcctgtattaggtggatatttatataat
ttccattatccagatatagtagattttaaaagagcagtacaattcgcttatggcacagtg
ctggcaagtgcgagagcaatagaggaatttaaaaaattacaaatagaaagggctaaaata
ggtattgttttaaacttaagtcctgtatatcccaggagtaatcatccggctgatttaaaa
gccgcagagattgcagatttgttctataacagaagttttttggacccaactgtcaaagga
gagtatcctaaagaacttgttgaacttctaaaaacttacaatcatctaccagagtattcg
gatagcgacttagaattaattaaaaataacactgtggaatatttaggagtaaattattat
cagccaattagagttaaagctaaagaaaatatgccaaatccatatggagtatttacacct
aattggttttatgatgagtatattatgccaggcagaagaatgaatccttatagaggatgg
gagatatacgaaaggggaatatatgacataatgataaatttaagagataattatggcaat
atagggtcttttatttcggaaaatggaatgggagttgaaggagaagagcgttttataaaa
gatggaattatccaagatgattacaggatagagtttataaaagaacatttgaagtggctc
cataaagcaattgaagagggatgcaatgtaaaaggatatcatttatggacttttatggac
aactggtccttcttaaatgcatataaaaaccgttacggtcttgtatctgtcgatctaaaa
acacagaaaagaactataaagaaaagtggatattggtataaagaattatccgaaaacaat
ggatttgttgattaa

DBGET integrated database retrieval system