KEGG   Thermoanaerobacter mathranii: Tmath_0433Help
Entry
Tmath_0433        CDS       T01250                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00860  Porphyrin and chlorophyll metabolism
tmt01100  Metabolic pathways
tmt01110  Biosynthesis of secondary metabolites
tmt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tmath_0433
Enzymes [BR:tmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tmath_0433
Exosome [BR:tmt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tmath_0433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADH60206
JGI: Tmath_0433
UniProt: D7ASI2
Position
466742..467716
Genome map
AA seq 324 aa AA seqDB search
MDLVKRPRRLRMNSILREMIRETSLDVSDLIYPLFVVPGDNIKEEIDSMPGVYHFSIDLL
VEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVREIKEKVPEIVVITDVCM
CGYTIHGHCGIVENGQVLNDKTVDYIAKIALSHVEAGADIVAPSDMMDGRVAAIRKLLDS
KGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMDYGNSNEALREIALDIEEG
ADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKAAAKMGWIDEKSVVLEILTS
IKRAGADMIITYFAKDVAKWLITL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatttggtaaaaaggccaagaaggcttaggatgaacagcattttaagggagatgata
cgagaaacttctttagatgtaagtgaccttatatatcctctttttgttgtgccaggagat
aatataaaagaagagatagattcaatgccgggtgtttaccatttttctatagatttgctt
gtagaagaggttaaagaagtgcgtgaccttggaattcctgctattttactttttggtgtg
ccttcatataaagatgaattggggtcagaggcttacagcgaggaaggtatcgttcaaaaa
gccgtaagagaaataaaagaaaaagtgccagaaattgtggtaataacagatgtatgtatg
tgtgggtatacaattcatggacactgtggcattgttgaaaatggacaagttctaaatgac
aaaacagtagactacattgctaaaatagcattgtcccatgttgaggcaggggcggatatt
gtagcgccttctgacatgatggatggaagagtagctgccataagaaagcttttagatagt
aaaggatttgtaaatacacctattatggcttacagtgctaaatacgcttcctctttttat
ggaccttttagagaagcagcaaattctttcccacaatttggcgacagaaagtcttatcaa
atggactatggaaattccaatgaagctttaagagaaatagctcttgacattgaagaagga
gcagatattgtcatggtaaaacctgcactttcttatcttgatattataaggcgggtaaag
gataatttcaacattcctattgctgcttataatgtaagtggagaatattcaatggtaaag
gcggcagctaagatgggttggattgatgaaaaatcggtagtcttagaaatactcacttca
attaaaagagcaggagcagatatgattataacttactttgcaaaggatgttgcaaaatgg
cttattaccctgtaa

DBGET integrated database retrieval system