KEGG   Thermoanaerobacter mathranii: Tmath_0495Help
Entry
Tmath_0495        CDS       T01250                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tmt  Thermoanaerobacter mathranii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
517954..518994
Genome map
AA seq 346 aa AA seqDB search
MDYKNLLKKLCESHGVSGHERGIYDLLKEEFATISDEVAEDKFGNLFFLKKGTKGKYKVM
LAAHLDEIGLIVKDIDDKGFIKFTTVGGVDQRTLPSQEVIVHGKKNILGVIGSKPPHLLS
SGDMEKAIKIEDMYIDVGMSKKEIEELIKIGDVITIKREFRELLNDYVSGKALDDRAGIA
VMAICLEELKKLYHYHDVYAIATLQEEVGVRGAATSAYNVEPDIAIAIDVTHGKARGVST
EIELGRGPAIGKGPNIHPAVYKGLVDTAKEYNINHQIEPLPGPSGTDAWAIQISRGGVPT
GLVSIPLRYMHTSVETVNMKDIINSGKLLAYYIANLPEELEGQLCY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggattataagaatttgctaaagaaattatgcgaaagccatggagtttctggacatgaa
agaggaatttatgatttattaaaagaagagtttgctacaatttctgatgaagtcgctgaa
gataaatttggcaatttattttttttaaaaaagggtacaaaaggtaagtataaggtaatg
ctggcagcccatttagatgaaataggtcttatagtaaaggatatagacgataagggattt
atcaagtttaccactgtagggggtgtagaccaaagaactcttccctctcaagaggtaata
gttcacggaaagaagaatatattgggagttatagggagcaaaccaccacatcttttgtct
tcaggggatatggaaaaggctataaagattgaggacatgtacatagatgttggaatgagt
aaaaaagaaatagaggaattaattaaaattggagatgtaataactataaaaagagaattt
agagagcttctaaatgattatgtttcaggtaaagctttggacgacagggcaggcattgct
gtaatggcaatatgccttgaggagcttaagaaattataccattatcacgatgtttatgca
atagcaacactgcaggaagaagtaggtgtaagaggagctgcaacttctgcttacaatgtt
gagccagatattgctattgctattgatgttacacatggtaaagcccgaggtgttagtaca
gagatagagctgggtagagggcctgcaattggaaaagggcctaatatacatccagctgta
tataaagggcttgtggatactgcaaaagagtacaatataaatcaccaaatagagccactt
cctggaccttcagggacagatgcatgggctatacagatttcaaggggaggagttccaaca
ggacttgtctcaatacctttaaggtacatgcatacatcagtggagactgttaatatgaag
gacatcataaatagtggaaagcttttggcctattatattgccaatcttcccgaggaattg
gagggacaactatgttattaa

DBGET integrated database retrieval system