KEGG   Thermoanaerobacter mathranii: Tmath_0497Help
Entry
Tmath_0497        CDS       T01250                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tmath_0497
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tmath_0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
520004..520987
Genome map
AA seq 327 aa AA seqDB search
MSLNIELIKKLTQTYGPSGSEEKVLQVIKEEVKNFCDEITYDALGNMICRKTGKGKKIMV
AAHTDEIGLMITHIEDEGFLRFTTIGGVFVEQIVGRRVVFKNGVQGAIGVEYLEDKKDFR
VEKLYIDIGAKNKEEAQKYVNIGDSASFAGEFIEAGDRLISKAFDDRIGCYVVIEALKNL
KTENEVYFVFTVQEEVGTRGAAAAAYNIHPDFAVAVDVTSTGDTPKAKKMAVSLGKGAAI
KVMDRSIIVSPSVREMMIEVAKENNIPYQLEILEFGGTDAGPIHLTKGGIPAGVISIPTR
YVHSISEMVDKNDIEASIELLKKVLEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaatatagaattgataaaaaaacttacacagacttatggaccttcaggaagt
gaggagaaagttttacaggtcataaaagaggaagtaaaaaatttttgtgatgagattaca
tacgatgcattagggaatatgatatgcagaaaaacaggaaaaggaaaaaaaataatggtg
gctgctcatacagatgaaataggacttatgattacacacatagaagatgaaggtttcttg
aggtttactactatagggggagtttttgtagaacagatagtagggaggagagtggttttt
aaaaatggagttcaaggagccataggagtagaatatttagaggataaaaaagattttaga
gttgaaaaattgtatatagatattggggcaaaaaataaggaagaagctcaaaaatatgtc
aatattggagatagtgcatcttttgcaggtgaatttattgaagcaggtgatagacttata
tcaaaggcttttgatgataggataggatgctatgtagttattgaggcactaaaaaatctt
aaaacagaaaacgaagtgtattttgtgtttactgttcaagaagaagtggggacaagagga
gctgctgcagctgcctataacatacatcctgattttgctgtagcagttgatgttacatca
actggcgatacacctaaagcgaaaaagatggcagtctctcttggtaaaggggcagctata
aaagtgatggacaggtcaataatagtaagtccttctgtgagggagatgatgattgaggta
gcgaaagaaaataacattccttatcagttagaaatacttgaatttggtggaactgacgca
ggacctatacatttgacaaaaggtggtataccggcaggtgttatatcgattcctacaagg
tatgttcacagcatatcagagatggtagacaaaaatgacattgaggcaagtattgaactt
ttgaaaaaagttcttgaaaagtaa

DBGET integrated database retrieval system