KEGG   Thermoanaerobacter mathranii: Tmath_0556Help
Entry
Tmath_0556        CDS       T01250                                 

Definition
RecD/TraA family helicase (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tmath_0556
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tmath_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
588797..591004
Genome map
AA seq 735 aa AA seqDB search
MVDIEGVVEEIIFRNEQNGYTVLELSTQGLAVTAVGYMPFVNIGERIKIEGEWVEHPDYG
EQIKVLNYQTLAPTTLEGIEKFLASGLIPGIGPVTARKIVKKFGVDSLNIIETAPERLKE
IKGLSDEKIKRICEAYEMQKGVKEVMVFLQGYGISTAMAIKIYKEYGNNAIEIIKQNPYR
LADDIFGIGFKTADKIAENLGVDPHSLYRISSGTRYVLMQYAANGHTYVPKELLKKEAAS
LLEVSEEEVEDSFVLLVQNEKIHIETFEDNTVGIYYIPYYIAELHTAERLFNMTLMENKD
LGLDVQKEIRNFEKETGILLAENQKLAVEEAVKNSVVVITGGPGTGKTTIINCIIRIFEK
AGKKVALAAPTGRAAKRITEATGKEAKTIHRLLEYTYSEEEGKGFNKNEKDPLKYDVIII
DEASMVDILLMNALLKALPIGAKLILVGDADQLPSVGAGNVLRDIIDSGIVKVIRLKEIF
RQQKQSLIVVNAHKINNGEYPTYNDKNSDFFFINANTQEDILKTILELVINRLPKAYGFH
PINDIQVLTPMRKGIIGVHNLNLELQKALNPHDKTKPEKTMKEFVFRVGDKVMQIKNNYK
IKWKKGDEEGEGVFNGDIGIIQSIDEELQELTVYFDDEKFVTYDFSDLDELNLSYAITVH
KSQGSEFPVVIIPITYGPPMLLTRNLLYTAVTRARKLVILVGQEKYLKFMIDNNRISKRY
SGLLSRLKKTLLYVN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggttgacatagagggcgtagttgaagaaataatttttagaaatgaacaaaatggttat
acagttttagaattaagtacccaaggcttagcagttactgctgtaggttatatgcctttt
gtaaacattggggaaagaattaaaattgagggagaatgggtagaacatcctgattacgga
gagcaaattaaggttttaaattatcaaaccttggctcccaccactttagaaggaatagaa
aagtttttagcttctggcttaattcctggaataggtcctgttacagcaagaaaaattgta
aaaaagtttggcgttgattctttaaatataattgaaactgcaccagaaagattaaaagaa
ataaaaggtctaagcgatgagaagataaaaagaatttgtgaagcttatgaaatgcaaaag
ggcgtaaaagaagtgatggtgtttttgcaggggtacggcatttctactgcaatggctata
aagatttataaagaatacggaaacaacgcgattgaaattattaaacaaaacccttacaga
ttagctgatgatatatttggaataggatttaaaacagcagacaaaatagcggaaaaccta
ggagttgaccctcattctctatatcgcatatcttctggtactcgatatgttttgatgcag
tatgcggcaaatggtcacacctatgtgccgaaagaattgttaaaaaaagaagcagcaagt
ttgttagaagtaagcgaagaagaagtagaagattcttttgtgcttttagtacaaaatgaa
aaaatacatattgaaacttttgaagataatactgtaggaatctactatataccttattat
atagctgaattacacacagcagagagattgtttaacatgacactaatggaaaataaagat
ttaggtttagatgtccaaaaagaaattagaaattttgaaaaagaaacaggtattttgtta
gcagaaaatcaaaaattggctgtagaagaagctgttaaaaattctgttgttgtcataacg
ggaggtccaggcacaggaaagactacaataataaattgtataatacgtatttttgaaaaa
gctggtaaaaaagtggctcttgcagcccctacaggaagagccgcaaaaaggataactgaa
gctactgggaaagaggcaaaaaccattcataggcttttagaatatacttattcggaagaa
gaagggaagggctttaacaaaaatgaaaaagacccattaaaatacgatgttataataatt
gacgaagcttcaatggtagatatattgcttatgaatgctttattaaaagccctacctata
ggggcaaaactgattttagtaggggatgctgatcagcttccatctgttggagccggaaat
gtcttaagagatataatagacagtggaatagtaaaagtgatacgtttaaaagaaattttt
agacagcaaaagcaaagtttgatagtagtaaatgctcacaagataaataatggagaatat
ccaacctataacgataaaaatagcgatttcttttttataaatgccaacacacaagaggat
atattaaagactatattggagcttgtcataaaccgacttcctaaagcttatgggtttcat
cctattaatgatattcaagtactcactcctatgagaaaagggataattggtgttcataat
ttaaatttagaactgcaaaaagcattaaatccccacgacaaaactaaaccagaaaaaaca
atgaaggaatttgtcttcagggtgggggataaagtgatgcagataaaaaataactacaag
ataaaatggaaaaaaggcgatgaagaaggggaaggagtgtttaacggagatataggaata
attcaatcaatagacgaagaattacaggaattgactgtgtattttgatgacgaaaaattt
gttacttatgacttttctgatttggacgaactaaatttgtcttatgccataacagtccac
aaaagccaaggcagtgaatttcctgttgtcataataccaattacttatggcccccctatg
ctacttacaagaaatcttttgtatactgctgttacaagggcaaggaaattggttattttg
gtagggcaagagaaatatttgaaatttatgattgataacaatagaatttcaaaaagatat
tcagggcttctttcaagacttaaaaaaacgcttttgtatgtaaactag

DBGET integrated database retrieval system