KEGG   Thermoanaerobacter mathranii: Tmath_0766Help
Entry
Tmath_0766        CDS       T01250                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tmath_0766
   00052 Galactose metabolism
    Tmath_0766
   00500 Starch and sucrose metabolism
    Tmath_0766
   00520 Amino sugar and nucleotide sugar metabolism
    Tmath_0766
Enzymes [BR:tmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tmath_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806803..807717
Genome map
AA seq 304 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKKKENLLHLVEDITNMVDIHYIRQKEPKGLGHAIYCARAFV
GNEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCTIIGVQQVPYEDVDKYGIVDSTPIEDR
LYKVNNLVEKPKKEETPSNIAILGRYIITPRIFEILENTSPGAGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLLEVARNLDPVGEEAASTI
TREV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaggaaggcgataattccggctgcaggccttggtaccaggtttttacctgct
accaaagcccagcctaaagaaatgcttccaattgtggacaaacccactattcagtacata
gttgaagaagcaatacagtctggaattgaagatatacttataataactgggaggaataaa
agagcgatagaagaccattttgataaatcagtagagttggagctggagttaaaaaagaaa
aagaaggaaaaccttttgcatcttgtggaagacattactaatatggtagatattcattac
attaggcaaaaagaaccaaaaggtttaggtcatgccatatactgtgcgagagcttttgtg
ggaaatgagccctttgctgttcttttgggggatgacatagtagatgctgaagttcctgtt
ttgaagcagatgattgaacaatacgaaaggtacaactgcactattattggagtgcaacaa
gtgccgtatgaggatgtagataaatacggtattgttgattctacacctattgaggacaga
ttgtacaaagtgaataatctcgtagaaaagcctaaaaaagaagaaacaccatcaaatata
gctattctgggaagatatataataacgccaagaatatttgaaatattggaaaacacgtca
ccaggagcaggaggtgagatacagcttacggatgctttaaaaactcttttaaattatgaa
gcaatttacgcctataattttattggcaaaagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaagacttaagagaaccttttaagaga
tatttattggaagttgcaagaaatttagatccggtgggagaagaagctgcatcaacaatt
acacgagaagtttaa

DBGET integrated database retrieval system