KEGG   Thermoanaerobacter mathranii: Tmath_0949Help
Entry
Tmath_0949        CDS       T01250                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tmath_0949
   00052 Galactose metabolism
    Tmath_0949
   00500 Starch and sucrose metabolism
    Tmath_0949
   00520 Amino sugar and nucleotide sugar metabolism
    Tmath_0949
Enzymes [BR:tmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tmath_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
982864..983730
Genome map
AA seq 288 aa AA seqDB search
MEIKKAVIPAAGLGTRFLPITKTIPKEMLPIVDKPVIHYIVEEAVNSGIKEILIITNKNK
KAIEDYFDKFDEIENEIKKSNKEELLPLIRDTCNLADIYYVRQKELKGLGHAISCAKAFV
GNQPFAVLLGDDLVDSKVPCLKQLINCYSKYNSPILGVQAIDKKDVVKYGIIDGIPLEDG
TYKVKSMVEKPKVSEAPSNIAVLGRYILTPQIFDILEKTEPGKNGEVQLTDALKVLAQQR
PIYAYHFEGKRYDIGDKFGFLQANIDYALKRKELRKSLIIYLQAVLKS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaaaaaggctgttattccagcagctggattaggaaccagattcttgccaatt
acaaaaactatacccaaggaaatgctacctattgtggataaacctgttatacattatatt
gtggaggaggctgttaattctggcatcaaagagatattgataattactaacaaaaacaaa
aaagcgatagaagattactttgacaagtttgatgaaattgaaaatgaaattaaaaaaagt
aacaaagaagagttattaccattaatacgggatacatgcaatttggctgatatttattat
gtaaggcaaaaagaacttaaaggattgggacatgcaataagttgtgcaaaagcttttgtt
ggtaaccaaccttttgcagttttgttgggtgatgaccttgttgacagcaaggttccatgc
cttaaacaattaataaactgctattctaaatacaattcacctattttaggagtgcaagct
attgataaaaaggatgttgtaaaatatggaattatagatggtataccacttgaggacgga
acttacaaagttaaaagcatggtagaaaaacctaaagtcagtgaagctccatcgaatatt
gctgtcttgggcagatatatactaactcctcagatatttgatatacttgaaaaaaccgaa
cctgggaagaatggagaggtacagcttacagatgcgttaaaagtattagcacagcagcga
ccaatatatgcttatcactttgaaggaaaaagatatgacattggggacaagtttgggttt
cttcaggctaatatagattatgcattaaagcgcaaagagttgagaaaaagccttataata
tatcttcaagctgttttgaaatcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system