KEGG   Thermoanaerobacter mathranii: Tmath_1062Help
Entry
Tmath_1062        CDS       T01250                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tmath_1062
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Tmath_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1087746..1088309
Genome map
AA seq 187 aa AA seqDB search
MIEYIRGMIEDIGQNYVIIDFMGIGIKVFVPFSTLKALPTKGNITKLYTYLHVREDGFQI
FGFKTKEELDLFEKLLSVNGVGPKGALSILSVVPIDNFAKVVNTGDYKALTLVPGIGKKT
AERIILELKDKLPKEIVFESDNNLSNEALEALLALGYSKSEAISALADITCNSVEETVKQ
ALKKLMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgagtatattagaggaatgattgaggatattggacaaaattatgtaataattgac
tttatgggtataggcataaaggtttttgttccattttctactttaaaagctttacctact
aaagggaatattactaagctttatacatatttacatgtgagagaagatggttttcaaatt
tttggctttaaaacaaaagaagagttagatttgtttgaaaagttattatctgttaatggg
gtagggcctaaaggtgctttatctattttatctgtggtccctattgataattttgcaaaa
gtagttaacactggcgattataaagctcttacattagttccgggaatagggaaaaagact
gctgagagaattattttggaattgaaagataagcttccaaaggagatagtttttgaaagt
gataataatctttcaaatgaggctttagaggctttattggcattaggttatagtaaaagt
gaagctatttctgctttggcagatattacttgtaacagtgtagaagagactgtaaaacaa
gccttgaaaaaattaatgaaatag

DBGET integrated database retrieval system