KEGG   Thermoanaerobacter mathranii: Tmath_1185Help
Entry
Tmath_1185        CDS       T01250                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tmath_1185
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Tmath_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1194410..1195276
Genome map
AA seq 288 aa AA seqDB search
MIEGKSLVNPGKFLGAIGEYEKANVVIVGLPMDYTVSFKAGSRFGPASIRQASYGLECYS
VYLDRRLEDKKYYDLGDLVLPYGNVEKSLDLISKTTENILKSEKKGIFLGGEHLVTYGIL
KEYLKKYGDNLVILHFDAHTDLREEFFGEPYSHATVMKRVWDIANGAKMYSFGIRSGEKE
EFEFAKKNIHMFLYDVVEPLKKLINDIKDYPIYISLDIDVIDPAFAPGTGTPEPGGITTK
EALEVIHILKDLNVVGMDLVEVSPSHDIAGITSILAAKIIRESILSFF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagggaaatctcttgtcaatccaggaaagtttttaggggctattggagaatat
gaaaaggcaaatgtagttatagtaggtttgcctatggattacacagtgagtttcaaggct
ggaagccgctttggacctgcttcgataaggcaagcttcttatggtttagaatgttacagc
gtatatttagatagaagattggaagataagaaatattatgatttgggagatttagtactt
ccttatggaaatgtggaaaagagtttagatttaatctcaaaaactacagaaaacatttta
aaaagtgaaaaaaaaggaatattcttgggtggagaacatttagtgacttatggaatttta
aaagagtacttaaaaaaatatggagataaccttgtaattcttcattttgatgcccatact
gatttaagagaagaattttttggtgaaccttattctcacgccacagttatgaaaagagtg
tgggacattgcgaatggtgctaaaatgtatagttttggaataaggtcaggggaaaaggaa
gaatttgaatttgccaaaaaaaatatccatatgtttttgtacgatgtagttgaacctttg
aaaaagttaattaatgatataaaagattatccaatttatattagtttggatatagatgtt
atagaccctgcttttgcaccaggcactggtacaccagaaccagggggaataactacaaaa
gaggcattagaggtaattcatattttaaaagatttaaatgtagtcggcatggatttagta
gaagtctcgccttctcatgatatagctggtataacctctattttagcagctaagattata
agggaatctattctttctttcttttaa

DBGET integrated database retrieval system