KEGG   Thermoanaerobacter mathranii: Tmath_1247Help
Entry
Tmath_1247        CDS       T01250                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00900  Terpenoid backbone biosynthesis
tmt01100  Metabolic pathways
tmt01110  Biosynthesis of secondary metabolites
tmt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tmath_1247
Enzymes [BR:tmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tmath_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NAD_binding_3 PrpR_N DapB_N
Motif
Other DBs
NCBI-ProteinID: ADH60962
JGI: Tmath_1247
UniProt: D7AP46
Position
complement(1256157..1257305)
Genome map
AA seq 382 aa AA seqDB search
MKKVIILGSTGSIGTQTLNVIKNFRENFEIVGLTAYNNVELLSKQIREFNPKVVAVKDED
KANQLREKLEENIEILTGSKGLQEIVKYEADLVVIAVEGIAGLLPTITAIQTGKDIALAN
KEVLVTAGQIVMDLAKKKGIRLLPIDSEHSAILQCLKGNDRKEISRLILTASGGPFRGKK
KEALKKVTVEQALNHPNWKMGKKITVDSATLMNKGFEVIEAKWLFDISEDKIDVVVHPQS
IIHSMVEYIDGSIIAQLATADMRIPIQYALNYPTRNYIKEVKFLDFSVITQLTFEKPDLE
TFRCLSLAYEALKIGGTMTTVLNAADEIAVSLFLNKKIEFLQIAEIIEESMKEHNNIQNP
TLDDIINVDKEVKEKIAKRYMR
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaataattctcggctcaactggttctattggtacacaaaccttaaatgta
ataaaaaattttagagaaaattttgagattgttggacttacagcttataacaatgtagaa
cttttatctaaacaaattagagaatttaatcctaaagttgtggcagtaaaagatgaagat
aaagctaatcaattacgtgaaaaactagaggaaaatatcgaaattctgactggcagcaaa
gggcttcaagaaattgtaaaatatgaagcggatttagtggtgatagcggtagaaggaatt
gccggacttcttccaacaattacagccatccagacgggaaaagatattgctttagcaaat
aaagaagtacttgtaacagctggacaaatcgtaatggatttagccaaaaagaaaggcata
aggcttttacctatagatagtgagcattccgctatacttcaatgtttaaaaggaaatgat
cgaaaagaaatatcgaggttgattttaacagcttctggtggcccttttagaggcaagaaa
aaagaggctttgaagaaagtgaccgtggaacaggctctaaatcatcctaattggaaaatg
ggaaaaaaaatcacggtagattctgccactttaatgaataaagggtttgaagtaattgag
gcaaaatggctatttgatatttctgaagataaaattgatgttgttgtacatcctcaaagc
ataattcattcaatggtagaatatatagatggcagcataattgcacaactggctactgcc
gatatgaggatacccattcagtatgccttaaattatcctactcgtaactacataaaagaa
gtaaagtttttggatttttctgttataacccaattaacttttgaaaaacccgatttagaa
acttttagatgtttgtcgttagcatatgaggctttaaaaattggaggaactatgactacc
gtattaaatgcagctgatgagatagctgtgtctttgtttttaaataaaaaaatagaattt
ttacaaatagctgaaattatagaggagagtatgaaagaacataataatatacaaaatccc
actttagatgatataataaatgtggataaagaggttaaggaaaaaatagcaaaaagatat
atgaggtga

DBGET integrated database retrieval system