KEGG   Thermoanaerobacter mathranii: Tmath_1417Help
Entry
Tmath_1417        CDS       T01250                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmath_1417
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmath_1417
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmath_1417
Enzymes [BR:tmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmath_1417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1413297..1414085)
Genome map
AA seq 262 aa AA seqDB search
MNRIDKKFEDLKKEGRKALITFITAGDPDIETTYDIVLALEEGGADIIELGIPYSDPLAD
GPTIQASSQRALNKGVKIPDIMRIVEKIRLKSDIPLVYLVYYNSIFKYGMQKFLEESKKA
GVDGLIIPDLPLEERKDILKEADKYSIYLIPLVAPTSKERIKLITENGKGFVYCVSITGV
TGARENIETDIEEYMKTVSQYTDMPKAIGFGISTPEMAKKLKDFSDGIIVGSAIVERIAK
GYNKSEMLKEVKSFVSSLKEVL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaataggattgacaaaaaatttgaagatttaaaaaaagaaggacgtaaagccttaata
acctttataacagcgggagacccagatattgagaccacttatgatatagttttggcttta
gaagaaggaggagcagatataatagaactgggaataccttattctgaccccttagctgat
ggtcctacaatacaggcatcctctcaaagagctttaaataaaggtgtaaaaatacctgat
ataatgagaatagtagaaaaaataaggttaaaaagtgatatcccgctggtttaccttgta
tactataactctatattcaaatatgggatgcaaaagtttttggaagagtcgaaaaaagca
ggagtagatggacttatcattccagatttgcctcttgaagaaagaaaagatattttaaaa
gaagcagataagtacagtatttatttgatacctttagttgcgcccacatcaaaagaaaga
ataaagttaattactgaaaatggcaaaggatttgtatattgcgtttcaattacaggtgtg
acaggtgcgagggaaaacattgaaactgatattgaagaatatatgaagactgtctctcag
tacactgatatgccaaaggcgatagggtttggcatatctactccggagatggcgaaaaaa
ttaaaagatttcagtgatgggattattgtaggaagcgccattgtagaaagaattgctaaa
gggtataataaatctgaaatgcttaaagaagttaagagttttgtatccagcttaaaagaa
gttttatga

DBGET integrated database retrieval system