KEGG   Thermoanaerobacter mathranii: Tmath_1418Help
Entry
Tmath_1418        CDS       T01250                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmath_1418
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmath_1418
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmath_1418
Enzymes [BR:tmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmath_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1414082..1415257)
Genome map
AA seq 391 aa AA seqDB search
MSGRFGRFGGQYVPETVMNALIELEREFEKAKQDKDFMEEYRYYLREYSGRPTPLYYAEN
LTKKLGGAKIYLKREDLNHTGAHKINNVLGQILLAKRMKKRRVIAETGAGQHGVATATAA
AMFGMECEIFMGEEDIKRQSLNVFRMKLLGAKVTPVKSGTGTLKDAVNEAIRDWVTNVDS
TFYVIGSVVGPHPYPTMVRDFQRVIGDEAREQILQKEGRLPDYVIACVGGGSNAMGIFYP
FIEDKEVKLIGVEAAGEGIETGKHAATMAKGSVGVLHGMMTYLLQDEEGRIMPVYSISAG
LDYPGVGPEHAFLKESNRAQYVYATDEEALTAFMDLSQTEGIIPALESAHALAYAMKLAP
NLRKDNIIIVNLSGRGDKDVNTVAKVLGVEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaagatttggacgttttggaggccagtatgtgccagagacagttatgaatgcg
cttatagaattagagagggaatttgaaaaagctaaacaggataaagatttcatggaagaa
tataggtattatttgagggaatattcaggaaggcctacacctttgtattatgctgagaat
cttactaaaaagctgggtggggcaaagatttatctaaagagggaagacctaaaccacaca
ggagcccataaaattaacaacgtattgggacagattttattggcaaaacggatgaaaaaa
aggagagttatagctgagacaggggcaggacagcatggagtggcaactgctacagctgct
gcaatgtttggaatggaatgcgaaatattcatgggagaagaggatataaagaggcaatct
ttaaatgtctttagaatgaaacttttaggtgcaaaagtaacaccggtaaaatcagggacg
ggtaccttaaaagatgcagtaaatgaagcgataagagattgggtgacaaatgtagatagt
actttttacgtgataggttctgttgttggtcctcatccttatcctactatggtgagagat
tttcaaagagtaataggggatgaggcaagagaacaaatacttcaaaaagaaggaagactt
cctgattatgtgattgcttgtgttggcggaggcagtaatgccatgggaattttctatccc
tttattgaagataaagaggtaaaattgataggtgtagaagcagcaggagaagggattgag
acagggaaacacgcagctacaatggcgaaaggttctgtaggagtattacacggcatgatg
acttatcttttacaggatgaagaggggagaataatgccggtatattctatatctgcagga
ctggattacccaggtgtaggtccagaacatgcctttttaaaagaaagtaatagagctcaa
tatgtgtatgcgacagacgaagaagcattgacggcttttatggatttatctcaaacagaa
gggataataccagctttggaaagtgctcacgctttggcatatgctatgaaactagctcca
aatttaaggaaagacaatattatcattgtaaatttgtcaggcagaggagataaagacgta
aatacagttgcgaaagtattgggggtggagttatga

DBGET integrated database retrieval system