KEGG   Thermoanaerobacter mathranii: Tmath_1560Help
Entry
Tmath_1560        CDS       T01250                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmath_1560
   01230 Biosynthesis of amino acids
    Tmath_1560
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmath_1560
   00051 Fructose and mannose metabolism
    Tmath_1560
   00562 Inositol phosphate metabolism
    Tmath_1560
Enzymes [BR:tmt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tmath_1560
Exosome [BR:tmt04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tmath_1560
  Exosomal proteins of bladder cancer cells
   Tmath_1560
  Exosomal proteins of melanoma cells
   Tmath_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1549552..1550322)
Genome map
AA seq 256 aa AA seqDB search
MTSKGVFALRRPIIAGNWKMHMTPSEAVKLVEELIPQVKEAKAEVVVIPPFVDLTEVSKV
IKGTNILLGAQNMFWEEKGAYTGEISPLMLKEIGVKYVVIGHSERRQYFGETDETVNKKV
LSALSHGLSPIVCVGESLSQREEGKTFEVVLSQTKEALKGVSPDDIVRVVIAYEPIWAIG
TGKTATAEDANEVIKAIRNTIASLYGKEKASLVRIQYGGSVKPENISELMAESDIDGALV
GGASLVATDFAKIVNY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtaaaggggtgtttgctttgagaagaccaataattgcaggtaattggaaaatg
cacatgaccccttctgaagctgtgaagttagttgaggaattgatacctcaagtaaaagag
gcaaaagcggaagtggtagtcatacctccttttgtggacttgacagaagtgagcaaagtc
atcaaaggtacaaatattcttttgggtgctcaaaatatgttttgggaagaaaagggtgca
tatacaggagaaatttcgcctttaatgcttaaagagattggcgtgaaatacgttgtaata
ggtcactctgaaagaaggcagtattttggtgagacggatgaaacggtaaataaaaaagtc
ttatccgctctatctcacggcttaagtcctattgtgtgtgtaggagaatctctttctcaa
agagaagaaggaaaaacttttgaagtagttttaagtcaaactaaagaggcattaaaaggc
gtttcgccagatgacatcgtcagggtagtaatagcttatgagccaatttgggctataggt
actggcaaaacggctacagctgaagatgccaatgaagtcataaaagctataagaaatact
atagcttccctttatggaaaagaaaaagcaagtttagttagaatacagtatggggggagt
gtaaaaccagaaaacatctctgaactcatggcagaaagcgatatagatggggctttagta
gggggagcaagtcttgtagcaacagattttgcaaagattgtcaattattaa

DBGET integrated database retrieval system