KEGG   Thermoanaerobacter mathranii: Tmath_1704Help
Entry
Tmath_1704        CDS       T01250                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tmath_1704
  Lipid metabolism
   00600 Sphingolipid metabolism
    Tmath_1704
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Tmath_1704
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tmath_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1703083..1705320)
Genome map
AA seq 745 aa AA seqDB search
MGRDVLNFNVDWLYIPEDLNDAYKFDFDESNFEVVSLPHANKTFPHHYFKEEDYRFVSWY
RKHFKVDERYKGKKVYIHFEGVMTVAKVYVNGEFVGEHKGGYTPFEFDITEYVKYGDFEN
LIAVQVDSREHKDIPPEGHLVDYMLFGGIYRNVWLKILNDTHIKDVYFVVDKLQNSVAEI
SITTTIEGKEVRNAKILTEVINKEGVVCSSSVTDVKDMQKEIVQRIKMENPLTWHPDHPY
LYNVSVKLVAENEILDNYTFKTGIRTVEFRDDGKFYINGEPLKLRGLNRHQTFPYVGGAM
PDRVQRKDADILKYELGLNYVRTSHYPQAVSFLDRCDEIGLLVFEEIPGWQHIGDENWKN
IAKENLKEMILRDRNHPCIFMWGVRINESLDDHDFYKEMNEIAHKLDRSRPTGGVRYLRD
SEKLEDVFTYNDFIYNLEGKIQLPNHKKYMVTEYMGHMYPTKSYDNLNRLITHARLHALI
QDKQYGIPNMAGASGWCAFDYNTTSAFGSGDNICYHGVCDIFRLPKFAAHFYRSQADPHL
YGPYVFIASYLIPSFREENGDKLLVFSNCEEIELYINDKFVMKQMPNRVDFPSLPYPPFE
FSLNQLGVNYMDMAIKANDVSITAVGLINGKEVARHTLRTYGKPDKLILSCDDNEIMADG
SDCTRVVVSVVDENGSILPYANIPVSFEIEGEGKLIGENPLALEAGRGAVYVKSTRKPGE
IILKAKSHYVAEESSVSIKTNSIGY
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagatgtattgaattttaatgtagattggctatatattcctgaagacttaaat
gatgcatataaatttgattttgatgagagcaattttgaagttgttagtcttcctcatgca
aacaaaacatttcctcaccactattttaaagaagaagactacaggtttgtttcatggtac
agaaaacattttaaagtagatgagagatataaagggaaaaaggtttatattcattttgaa
ggtgttatgactgttgcgaaggtttatgtaaatggcgaatttgtaggagaacataaagga
ggatataccccttttgaatttgacattacagaatatgtcaaatatggcgattttgaaaat
ttaattgctgtacaagtggattcaagagaacataaagatattcctccagaaggtcatctt
gtagattatatgttgtttggtggaatatacagaaatgtatggctgaaaattttaaatgat
acccatataaaagatgtttattttgttgtagataaattgcaaaattctgttgcggaaatt
tcaattactacaaccatcgaaggtaaagaggtaaggaatgcaaaaatattgacagaggtt
ataaataaagaaggtgttgtgtgttcatcttcggttactgatgttaaagacatgcaaaag
gagattgtacagcgaataaagatggagaatccattaacttggcatccagatcatccgtat
ttatataatgtgtctgtaaaacttgttgcagagaatgaaattttagataattatactttt
aagacaggaataaggacagttgaatttagagatgacggcaaattttatattaatggtgaa
cctttaaaattaagaggattaaacagacatcagacttttccttatgttggcggtgctatg
ccggatagagttcaaagaaaagatgcagatatattaaagtatgaattgggattaaattat
gttaggacgtcacattatccgcaggctgtttcatttttggatagatgtgatgagataggt
ttgttagtttttgaagagatacctggatggcagcatataggcgatgaaaattggaagaac
attgcaaaagagaatttaaaagaaatgattttaagagatagaaatcatccatgcatattt
atgtggggcgtacgaataaatgagtctttagatgaccacgatttttataaagaaatgaat
gaaatagctcataaattagacagaagtagaccaacaggtggtgttagatatttaagagat
agtgaaaagctagaggatgtatttacatataacgactttatatacaatttagaaggcaaa
atacaacttccaaatcacaaaaagtatatggtaacagaatatatgggtcacatgtatccg
acaaaatcttatgataaccttaatcgacttattactcatgcaaggttgcatgctcttatc
caagacaagcaatatggaataccaaacatggctggtgcatcaggctggtgtgcatttgat
tataataccacaagtgcttttggttcaggagacaatatatgctatcatggagtctgtgat
atatttaggcttccaaaatttgcagctcatttttacagaagccaggctgatcctcactta
tatgggccctatgtgtttatagcttcgtacttaataccatcatttagagaagaaaacggt
gacaaattgcttgtatttagcaattgtgaagaaatagaactttatataaacgataagttt
gtaatgaagcaaatgcctaatagagttgactttccaagtctgccatatccgccatttgaa
ttttcattaaatcaactgggagttaactatatggatatggcgataaaagctaatgatgtt
tctattactgcagtaggtttaataaatggtaaagaagtagcaaggcatacattaaggaca
tatggaaagcccgataaattaattctctcttgtgatgataatgagattatggcagatggc
tccgattgtacaagggttgttgtaagtgttgtagatgaaaatggatctattcttccttat
gctaatataccagtatcatttgaaatagaaggtgaaggaaagctgattggggaaaatcca
ttggcattagaagcaggaagaggagcagtttatgtaaaatcaacacgaaagccgggagaa
ataattctaaaagctaaatctcattatgtagcggaagaaagcagtgtatctataaaaact
aattcaataggatattaa

DBGET integrated database retrieval system