KEGG   Thermoanaerobacter mathranii: Tmath_1705Help
Entry
Tmath_1705        CDS       T01250                                 

Definition
(GenBank) Alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00052  Galactose metabolism
tmt00561  Glycerolipid metabolism
tmt00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tmath_1705
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tmath_1705
   00600 Sphingolipid metabolism
    Tmath_1705
Enzymes [BR:tmt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tmath_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Melibiase_2 Glyco_hydro_31 GHL10
Motif
Other DBs
NCBI-ProteinID: ADH61410
JGI: Tmath_1705
UniProt: D7AQT8
Position
complement(1705324..1707510)
Genome map
AA seq 728 aa AA seqDB search
MAIYYDERTRTFHLVAKDTSYVVYVSTYGHLFHVYFGKRIKDESTIHLSSEVEKVYVSVV
EQRKNFSFEVMPQEYPAYGNTDFRSPAYQIQLENGSTVSDLRYLSHKIYKGKPKLEGLPA
TYVENEDEADTLEIELYDKVANLKVTLIYTAFRDYDVITRSVRFENMGKEDIKLLRALSM
NVDFNDDKFDMLQLSGAWARERHVIRRPLTPGVQSIESRRGASSHQQNPFIALLRKDADE
WHGDVYGFSLVYSGNFLAQVEVDQYKMARVSMGINPFDFSWLLKPGETFQTPEVVMVYSD
SGLNKMSNTYHKLYRNRLMRSKFKDKERPILINNWEATYFDFTEEKLKELAKEAKDLGIE
LFVLDDGWFGKRNSDNSSLGDWFVNKEKIPSGLDGLAKEINSLGLKFGLWMEPEMVSPDS
DLYREHPNWCIHVPNRPRSESRNQLVLDLSRKDVQDYIIKVVSDILESANISYVKWDMNR
NMTEIGSALLPPERQRETAHRYILGLYRILEEITTRFPDVLFESCAGGGGRFDPGMLYYM
PQTWTSDNTDAVERLKIQYGTSIVYPLISMGSHVSAVPNHQVHRITPLKTRLDVAISGNF
GFELDLTKLSEEEKDLAKKYVKKYKEIRKLIQFGDFYRLLSPFEGNETAWMFINEEKTEF
VAFYFKVLATPNDTIKRIYLKALNPDYKYALQDTGEVYGGDELMYAGIAIPQLEGDFQSV
MMHFKKEA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggctatatattatgatgaaagaacaagaacgtttcaccttgtagcaaaggatacaagt
tatgtagtatatgtgagtacttatggtcatctgtttcatgtttattttggcaaaaggata
aaagatgaaagtactattcatttaagttctgaagtagaaaaagtatatgtatcagttgtg
gagcaaaggaaaaatttttcatttgaggtaatgccacaagaatatcctgcgtatggcaat
actgattttagaagtcctgcatatcaaattcagcttgaaaatggttctactgtttctgat
ctaaggtacttatctcacaaaatctataaaggtaagcctaaattagaagggcttccggct
acttatgttgaaaatgaagatgaagctgatactcttgaaatagagttatatgataaagta
gcaaatttaaaagtaactttaatttacacagcatttagagattatgatgttatcacaagg
tcagtgagatttgaaaacatgggaaaagaagacataaaattgttaagagctttgtctatg
aatgttgattttaatgatgataagtttgacatgcttcaattgtcaggggcttgggcgaga
gaaagacatgttataagaagaccacttactcctggagttcagtctattgaaagcagaaga
ggtgcaagcagccatcagcaaaatccttttatagcacttttaaggaaagacgctgatgaa
tggcatggagatgtttatggatttagccttgtttacagtggcaatttcttggcacaagta
gaagtggatcaatataagatggcgagagtctctatgggaattaatccatttgatttttca
tggcttttaaaaccaggtgaaacatttcaaacaccagaagtggttatggtttattcggat
agtggcttaaataaaatgtcaaatacctatcacaaactgtacagaaatagacttatgaga
agtaaatttaaggacaaagaaagaccaattcttataaacaattgggaagctacttatttt
gattttaccgaagaaaaacttaaagaacttgctaaagaagctaaagatttgggtattgaa
ttgtttgttcttgacgatggatggtttggaaagagaaattctgacaattcttcactggga
gattggtttgtaaataaagaaaagattccaagtggtttggatggtcttgcaaaagagata
aattctttaggtttaaaatttggattatggatggaaccagaaatggtgtctcctgatagt
gacctctatagagagcatcccaattggtgtatacatgtacctaataggccgagaagtgaa
agcagaaatcaacttgtgttagacttgtcgcgcaaagatgtacaagattatattataaaa
gtagtgtcagatattttggaaagcgccaacataagttatgtaaaatgggatatgaataga
aatatgacagagataggctctgcacttttgcctcctgaaagacaaagagaaactgctcac
agatatattcttggactttacagaatattagaagaaataacgacaaggtttcctgatgtt
ttgtttgaaagttgtgctggtggtggcggtcgttttgaccctggaatgctttattatatg
ccccagacttggactagtgataatacagatgcagttgaaagacttaaaatacagtatggt
acaagtatagtttatcctcttatttcaatgggaagccatgtgtctgctgtgcccaatcac
caagttcatagaataactcctttaaagactcgtcttgatgtggcgatatcaggtaatttt
ggatttgagcttgatttaacaaagcttagtgaagaggaaaaagaccttgctaaaaaatat
gttaaaaagtacaaagagataagaaaattgattcaatttggagatttttacagattatta
agtccttttgaaggaaatgaaacagcatggatgtttattaatgaagaaaaaactgaattt
gtggctttttactttaaagtcttggcaactcctaatgacacgataaaaaggatttattta
aaggctttaaaccccgattacaaatatgcattgcaagatacgggtgaagtgtatggtggt
gatgagcttatgtatgcaggcattgcaataccacaattggaaggagattttcaaagtgtt
atgatgcattttaaaaaggaggcgtaa

DBGET integrated database retrieval system