KEGG   Thermoanaerobacter mathranii: Tmath_1781Help
Entry
Tmath_1781        CDS       T01250                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tmath_1781
Enzymes [BR:tmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tmath_1781
Exosome [BR:tmt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tmath_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1790340..1791833)
Genome map
AA seq 497 aa AA seqDB search
MAKYIMAFDQGTTSSRAIIFDHSGKIVASQNQEFKQIYPKAGWVEHDPMEIWGTQIGVAK
GVIEKAGINPEDIAAIGITNQRETTVVWDKNTGKPIYNAIVWQCRRTAPICDELKNKGFD
KKIREKTGLVVDAYFSGTKIKWILDNVEGAREKAEKGELLFGNIDTWLIWNLTRGKVHVT
DYSNASRTMIFNIHELKWDKEILAELNIPEQMLPEVKPSSYVYGYTDKSIFGVEIPIAGD
AGDQQAALFGQACFKPGMAKNTYGTGCFMLMNTGEKAVPSNTGLLTTIAWGIDGKVEYAL
EGSIFIAGAAIQWLRDELRIIDNSPQSEEYALKVEDTNGVYVVPAFVGLGAPYWDMYARG
TIVGLTRGAKREHIIRATLESIAYQTRDVLEAMQEDSGIRLQALKVDGGASANNFLMQFQ
SDILGVPVDRPQVIETTALGASYLAGLAVGFWNSREEIEKNWNVDKHFEPAMDNEKREKL
YKGWKKAVERAMKWAEE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagtacattatggcttttgaccaggggacaacaagttcccgtgcgataattttt
gaccatagtgggaaaattgtggcttcacaaaatcaagaatttaagcaaatttatcctaag
gcaggttgggtagaacatgatccaatggagatatggggtacacaaataggtgttgcaaaa
ggtgttatagaaaaagcgggtattaatccggaggatattgcagctattggcattacaaat
cagagagagacaactgttgtgtgggataaaaatacaggaaaacctatttacaatgcaata
gtatggcaatgcaggaggactgctcctatatgcgatgaactaaaaaataaaggttttgac
aagaaaattagagaaaaaaccggacttgtagtagatgcatatttttctggtactaaaata
aaatggattttggataatgttgaaggagcaagagaaaaagcagaaaaaggagaattgctt
tttggaaatattgatacatggcttatttggaatttgacaagaggtaaggtacacgtaacc
gactattccaatgcttcaaggacgatgatctttaacatacatgagcttaaatgggataaa
gagatattggctgaacttaacataccagagcaaatgcttccggaagttaagccttccagt
tatgtatatggctatactgataaaagtatatttggagtagagatacctattgccggagat
gcgggagaccagcaggcagctttgtttggtcaagcttgttttaaacctgggatggcaaaa
aacacctatggaacaggctgctttatgcttatgaatacaggggaaaaggctgtaccttcc
aatactggacttctcactacaatcgcttggggaattgatggaaaagtagaatatgcctta
gagggtagtatatttatagcaggtgctgcgatacagtggttgagagacgaacttagaata
attgacaattcaccgcaaagtgaagaatatgcgctgaaagttgaagacacaaacggtgta
tatgttgttcctgcttttgtaggacttggagcaccttattgggatatgtatgcaaggggt
acgattgtaggacttacaaggggagcaaaaagggaacatataataagggcaacactggaa
tccattgcttatcagacaagagatgtattagaggctatgcaagaggattcgggaatcaga
ttacaagctttaaaagttgacggtggagcaagtgctaataacttcttgatgcaattccaa
tctgacattttaggcgttccggttgacaggcctcaagtaattgaaactactgctttaggt
gcttcttatcttgcaggattggcagtaggattctggaacagcagagaagaaatagaaaag
aattggaatgttgataagcattttgaacctgctatggataatgaaaagagagaaaaactg
tataaaggttggaaaaaggctgtagaaagggctatgaaatgggctgaagaataa

DBGET integrated database retrieval system