KEGG   Thermoanaerobacter mathranii: Tmath_1798Help
Entry
Tmath_1798        CDS       T01250                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00340  Histidine metabolism
tmt01100  Metabolic pathways
tmt01110  Biosynthesis of secondary metabolites
tmt01230  Biosynthesis of amino acids
Module
tmt_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Tmath_1798
Enzymes [BR:tmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Tmath_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HOIP-UBA
Motif
Other DBs
NCBI-ProteinID: ADH61496
JGI: Tmath_1798
UniProt: D7AR24
Position
complement(1807591..1808874)
Genome map
AA seq 427 aa AA seqDB search
MIEIFDFRKGIDNGILQKLHNRSKLENKEIAKKVEEIISNVGERKDQALFEYTYMFDGIN
LDKSTVKVTKEEIKNAYKEVEGEFLKAIDKAIKNITEFHEKQKQSTWMDFKEGIVYGQII
RPLSQVGIYVPGGTASYPSSVLMNGIPAKVAGVEKIVMVSPAGKKGINPYVLVAADRIGI
EDIYKVGGAQAIAALAFGTESIPKVDKIVGPGNIFVAMAKRALYGYVDIDMVAGPSEVLV
IADETANPKYVAADLLSQAEHDVMASSILVTTSLEVAQQVKIEIERQMEYLERKEIIEKS
LKNFGAIIVVNNLKEAIGIANDIAPEHLELNISNAFEIIGEIKNAGAVFVGEYSPEPLGD
YLAGPNHVLPTSGTARFFSPLSVTDFIKKMNILYYSKDSLEEVKKDVITFANSEGLTAHA
NSIKVRF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgattgagatatttgattttcgaaagggaattgacaatggcattttgcaaaagcttcac
aacagaagtaaattagagaataaagaaatagcaaaaaaagtggaagaaataatttcaaac
gtaggagagagaaaagaccaggctttgtttgagtatacttacatgtttgacggaataaat
cttgacaaaagtactgtaaaagttacgaaagaggaaataaaaaatgcttataaagaagtt
gaaggagaatttttaaaagcgattgacaaagctatcaaaaacataacagaatttcatgaa
aagcaaaaacagtctacatggatggattttaaagaaggtatagtttatgggcagataata
agacctctttctcaagttggaatttatgtgccggggggaaccgcttcttatccttcttca
gttttgatgaatggaatacctgcaaaggtggctggtgtagagaaaatagtgatggtttct
ccagctggtaagaagggaataaacccttatgtgttagtggctgcagataggataggaata
gaggatatatataaagttggcggtgcacaggctattgcagccttggcctttggtacagag
tcaatacctaaggttgataaaatagttggcccgggaaatatttttgtcgcaatggctaaa
agagctctttatggatatgtagatattgatatggtggcagggcccagtgaagttttggta
atagctgacgaaactgctaatcctaaatatgtggcggcggacctgctgtcacaggcggaa
cacgatgtaatggcatcttcaatacttgtcacaacatctttggaggttgcgcaacaagta
aaaatagaaattgaaaggcaaatggaatatcttgaaaggaaagaaataattgaaaagtct
ttaaaaaattttggcgcgataattgttgtaaataatttaaaagaagcaattggtattgca
aacgacatagctccggagcatttagagcttaacatttccaatgcctttgaaataattggt
gaaatcaagaatgcaggagcagtctttgtgggagaatattctccagaacccttaggggac
taccttgctggtcctaaccatgtgcttcctaccagtggaacagcaaggtttttctcgcct
ctttctgtgacggactttatcaaaaagatgaatattctctattattctaaggattcttta
gaagaggtaaaaaaggatgtaatcacttttgcaaattcagaagggcttaccgctcatgct
aattctataaaagtgaggttttaa

DBGET integrated database retrieval system