KEGG   Thermoanaerobacter mathranii: Tmath_2073Help
Entry
Tmath_2073        CDS       T01250                                 

Definition
phosphoglycerate mutase 1 family (EC:5.4.2.4)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmath_2073
   01230 Biosynthesis of amino acids
    Tmath_2073
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmath_2073
  Energy metabolism
   00680 Methane metabolism
    Tmath_2073
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmath_2073
Enzymes [BR:tmt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Tmath_2073
Exosome [BR:tmt04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Tmath_2073
  Exosomal proteins of melanoma cells
   Tmath_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2080766..2081521)
Genome map
AA seq 251 aa AA seqDB search
MYKVVLLRHGESLWNMENRFTGWTDIDLSPKGVEEARESGKTLKAEGYIFDCAFTSVLKR
AIRTLWIVLDELDLMWIPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKIWRRSADVR
PPALEKDDPRYPGFDPRYADLSEEEIPLTENLIDTINRVTSYWESTIAPTIKSGKKVLIV
AHGNSLRGLVKYLDNLSNEEIMELNIPTGIPLVYELDGDLKPIKHYYLADEEKVKEKKEL
VAKQGKVQGNS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagttgttttgctaagacacggagaaagcctgtggaatatggaaaacaggttt
actggctggacggatattgatttatctccaaagggagttgaagaagctcgggaaagtggc
aagactttaaaggcagaagggtatatttttgactgcgcttttacttcggttttaaaaaga
gctataagaactttgtggattgttcttgacgaattagatttgatgtggataccggtttat
aaatcatggaggctcaatgaaaggcattatggagcactgcaagggctaaataaagctgaa
actgccaagaaatacggagaagagcaggtaaaaatatggagaaggtctgctgatgtaagg
ccacccgccttagaaaaagatgacccgagatatcccggctttgaccccagatatgctgac
ctttctgaagaagaaattccccttactgaaaatttgattgatacaattaacagagttact
tcctattgggagtccacaattgcaccgactattaaatcaggtaaaaaagtgctaatagtt
gctcatggaaatagtttgagagggcttgtaaaataccttgacaatctttcaaatgaagag
ataatggagctaaacattcctacaggaattccactagtttatgagcttgatggtgattta
aagcctataaagcattattatcttgccgatgaagagaaggtaaaagagaagaaagaattg
gtagctaaacaaggaaaggttcaagggaattcttaa

DBGET integrated database retrieval system