KEGG   Thermoanaerobacter mathranii: Tmath_2110Help
Entry
Tmath_2110        CDS       T01250                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tmath_2110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmath_2110
   00620 Pyruvate metabolism
    Tmath_2110
   00650 Butanoate metabolism
    Tmath_2110
  Lipid metabolism
   00071 Fatty acid degradation
    Tmath_2110
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tmath_2110
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tmath_2110
   00626 Naphthalene degradation
    Tmath_2110
Enzymes [BR:tmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tmath_2110
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tmath_2110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2128079..2130697
Genome map
AA seq 872 aa AA seqDB search
MPTLLQEKKETKEKTEVKETTDVKKQIDLLVERAKRAQEKFMSYTQEQIDEIVKVMALAG
IEKHVELAKLAHEETKMGVYEDKITKNLFAVEYVYNYIKDKKTVGILSENLEENHMEVAE
PVGIIAGVTPVTNPTSTTMFKCLIAIKTRNPIIFSFHPKALKCSIEAAKTMYEAALKAGA
PEGCIGWIETPSIEATQLLMTHPGVSLILATGGAGMVKAAYSSGKPALGVGPGNVPCYIE
KTANIKRAVSDLILSKTFDNGTVCASEQAVIIDEEIANEVKKLMREYGCYFLNKEETKKL
EEFAIDKNTGLMNPAVVGQPAVKIAQMAGFKVPENTKILVAEYPAVGPKYPLSREKLSPI
LALYTVKDYKEGIKRCEEMIQFGGLGHSAVIHSENQQIINEFANRVQASRILVNAPASQG
AIGDIYNTATPSLTLGCGTMGGNSTTDNVSVYNLINIKRVFIRKERMKWFRVPPQIYFER
GSIQYLSQVKGKKAFIVTDPAMVKLGFVDKVTYQLDKANIKYEIFSEVEPDPSVDTVEKG
IKIMKEFEPDLLIAVGGGSAIDAAKGMWLFYEYPDTKFEDLRLKFMDIRKRTYRFPELGK
KALFIAIPTTSGTGSEVTAFAVITDKKKNIKYPLTDYELTPDIAIIDPDFVMTIPPSVTA
DTGMDALTHAIEAYVSVMASDYTDALAEKAIKLIFEYLPKAYKNGQDKVAREKMHNASCI
AGMAFTNAFLGINHSMAHILGAKFHLPHGRANAILLPYVIEYNAELPKKFASFPQYEYPK
AAEKYAEIAKFLGLPASTTDEGVKSLIEAIKNLMKELNLPLTLKDAGINKEEFEKQIMEM
ADIAFNDQCTGSNPRMPLVSEIAEIYRKAYGE
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
atgcctactttattacaagaaaaaaaggaaacaaaagaaaaaacagaagtaaaagaaaca
acagatgttaaaaaacaaatagacctattagtagaaagggcaaaaagagcccaagaaaaa
ttcatgtcatacactcaagagcaaattgatgaaatagtcaaagttatggcactagcgggc
atagaaaagcatgtagaactggcaaaattagctcatgaagaaacgaaaatgggggtttat
gaagacaaaataacgaaaaatctctttgcagtagaatatgtgtacaattatataaaagac
aaaaagactgtcggcatccttagtgaaaacttagaagaaaatcatatggaagtggcagag
cctgtaggaattatagcaggggttacccccgtgacaaaccctacctctacaacaatgttt
aaatgcttaatagctatcaaaacaagaaatccaataatttttagtttccatcccaaagca
ttaaaatgtagtatagaagcagcaaagaccatgtacgaggcagcattaaaggcgggtgct
cccgaaggatgcataggttggattgaaacaccttcaattgaagcaacgcaacttctcatg
acacaccccggcgtctcccttatcctcgcaacaggcggtgcgggaatggtaaaagctgct
tacagctcaggaaaacccgcccttggcgtaggtcctggcaatgtcccctgctacattgaa
aaaactgcaaatattaaaagagcggtctcagacctaatacttagcaaaacttttgacaat
ggcacagtatgcgcatcagaacaagctgtgataatagatgaagaaatagccaatgaagta
aaaaaattaatgagagaatatggttgctatttcttaaataaagaagaaactaaaaagtta
gaagaattcgctatagacaaaaacaccggtttaatgaatccagcagttgtgggtcagcct
gcagtgaaaattgctcaaatggctggatttaaagttcctgaaaataccaaaatacttgta
gctgaatatccagctgtaggtcctaaatatcctctatccagagaaaaactaagcccaata
cttgctttatacacagtcaaagattacaaagaaggtataaaaagatgcgaagaaatgata
caattcggcggacttggtcactctgcggtaatacattctgaaaaccaacaaattattaat
gaatttgcaaatagagtacaagcaagtagaatccttgtaaacgcccctgcttcacaaggc
gctattggagacatttataacacggctactccatctttgactttgggttgcggtacaatg
ggtggaaattcaacaacagataatgtaagtgtttataaccttataaacataaaacgagtt
tttataagaaaagagagaatgaaatggttcagagttccaccacaaatctattttgaaaga
gggtcaatacagtatctatcacaagtaaaaggcaaaaaagcttttattgtaacagaccct
gcaatggttaaattaggttttgtagataaagtgacatatcaattagataaagcaaatatt
aaatatgaaattttctctgaagtagaaccagacccatcagttgacactgtagaaaaaggg
ataaaaataatgaaggagttcgagcctgacttactaatagctgtaggtggtggttctgca
atagacgcagcaaagggaatgtggcttttttatgagtaccctgacacaaaatttgaagac
ttaaggttaaagttcatggacataagaaaaagaacttatagatttcctgaactcggcaaa
aaagctttatttatcgcaataccaaccaccagcggtacaggttctgaagtcacagccttt
gcagttataacagacaaaaagaaaaatataaagtaccctcttacagattacgaattgaca
ccagatattgctataatagaccctgactttgtcatgacaattccaccctctgtaactgca
gatacaggtatggatgctttaactcatgccattgaagcttatgtatccgtgatggcatca
gactatacagacgccctcgcagaaaaagccataaaactgatatttgaatatctccctaaa
gcatataaaaacggacaagacaaagtcgcccgcgaaaagatgcacaatgcttcttgcata
gcaggaatggcattcacaaatgcatttttaggaataaaccacagtatggcccacatactt
ggcgctaaattccaccttccccatggaagggcaaatgcgatacttctgccctatgtcata
gaatacaatgctgagttacctaaaaaatttgcctcattcccacaatatgaatatcccaaa
gcagccgagaaatacgcagaaattgcaaaattcttaggacttcctgcatcaaccactgat
gaaggagtaaaaagtctcattgaagcaataaaaaatctcatgaaagagttaaatcttcct
cttacacttaaagatgcgggaataaacaaagaagaatttgaaaaacaaataatggaaatg
gctgatatagccttcaacgaccagtgcaccggttcaaatccaagaatgccattggtatca
gaaattgcagaaatatatagaaaagcctatggagaataa

DBGET integrated database retrieval system