KEGG   Thermoanaerobacter mathranii: Tmath_2178Help
Entry
Tmath_2178        CDS       T01250                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmath_2178
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmath_2178
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tmath_2178
Enzymes [BR:tmt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tmath_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2201358..2202410)
Genome map
AA seq 350 aa AA seqDB search
MKWQGLIKAYREFLPKIKEENIVTLKEGNTPLYEAINLQKLFPGIKIYLKYEGLNPTGSF
KDRGMTVAVSQAKEEGSNAVVCASTGNTSASAAAYAAKAGLKSIVLIPGGKIALGKLAQA
IAYGAKVIAINGNFDDALKLVREISKKFPITLVNSINPYRLEGQKTASFEICDELKDAPS
YVALPVGNAGNITAYWMGFKEYYNAKKITRLPKMLGFQAAGAAPIVENRVIENPETIATA
IRIGNPASWRKAVAARDESGGLIDKVTDEEILEAYNLLAKKEGIFAEPASAASIAGVIKK
YKEGFFKEGESVVCVLTGNGLKDPDTAVKLGGEIKTIEANLKALEEVLYG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtggcaaggactaataaaagcttatagagaatttttacctaaaataaaagaggaa
aacatagttactttaaaagaaggcaatacacctctttatgaggctataaatcttcaaaaa
ctttttccaggcataaaaatatatctgaaatatgaagggttaaacccaacaggttctttt
aaagacaggggtatgactgtagcagtatcgcaggcaaaagaagagggctctaatgcagtc
gtgtgtgcttcaacaggaaatacttctgcttctgcagctgcctatgcagcaaaagcaggt
cttaaaagcatcgtactcatacctggtggcaaaattgccttaggaaagcttgctcaagca
attgcttatggtgctaaagtcattgccataaatggaaactttgatgatgccttaaaattg
gttagagaaatttcgaaaaaatttcccataactttggtgaattccataaatccttataga
ttagaaggacaaaagacggcttcttttgaaatatgtgatgaactcaaagatgcaccctct
tacgttgccctccctgttggaaatgcggggaatattactgcctattggatgggctttaaa
gaatattataatgccaaaaaaataacgagacttcctaaaatgttaggttttcaggctgct
ggggctgcgcctatagttgaaaacagagtaattgaaaacccagagactattgcaacagct
atacgaataggcaaccctgccagctggcgaaaggcagttgctgcaagggatgagtcgggt
ggacttattgacaaagttacagatgaagaaatactagaagcttataaccttttagctaaa
aaggagggcatttttgcagagcctgcttcagcagcttctattgcaggggttataaaaaaa
tacaaggaaggattttttaaagaaggagagtctgttgtttgtgtgttaactggaaatggc
ttaaaagatccagatacagctgttaaattaggaggagagataaaaacgatagaggcaaat
ctaaaagcattggaggaagttttgtatggatag

DBGET integrated database retrieval system