KEGG   Thauera sp. MZ1T: Tmz1t_0124Help
Entry
Tmz1t_0124        CDS       T00804                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tmz  Thauera sp. MZ1T
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:tmz01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tmz00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tmz00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:tmz00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
151176..151517
Genome map
AA seq 113 aa AA seqDB search
MRLFTGQRAWVVQRLSALLLLVLILLAMLALPFASPLDFSAWRALAGGALGGPLIALLFG
ALCAHAWVGMRDIVLDYLQPRGLRLAVLGLITVVLLGVLARVLLSLAMVALAA
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgttcacagggcaacgggcatgggtggtgcaacgcctcagcgccttgctgttg
ctggtgctgatcctgctcgccatgctcgcgctgcctttcgcgtcgccgctcgatttctcc
gcgtggcgcgccttggccggcggcgcgctgggggggccgctgatcgcgctgctgttcggc
gccttgtgcgcgcacgcctgggtaggcatgcgcgacatcgtgctcgactacctccagccg
cgcggactgcggctggcggtgctgggcctgatcacggtcgtgctgctcggcgtgctggca
cgcgtgctgctgagcctggccatggtggcgctcgccgcctga

DBGET integrated database retrieval system