KEGG   Thauera sp. MZ1T: Tmz1t_0876Help
Entry
Tmz1t_0876        CDS       T00804                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00071  Fatty acid degradation
tmz00280  Valine, leucine and isoleucine degradation
tmz00281  Geraniol degradation
tmz00310  Lysine degradation
tmz00360  Phenylalanine metabolism
tmz00362  Benzoate degradation
tmz00380  Tryptophan metabolism
tmz00410  beta-Alanine metabolism
tmz00627  Aminobenzoate degradation
tmz00640  Propanoate metabolism
tmz00650  Butanoate metabolism
tmz00903  Limonene and pinene degradation
tmz00930  Caprolactam degradation
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
tmz01212  Fatty acid metabolism
Module
tmz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tmz1t_0876
   00650 Butanoate metabolism
    Tmz1t_0876
  Lipid metabolism
   00071 Fatty acid degradation
    Tmz1t_0876
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tmz1t_0876
   00310 Lysine degradation
    Tmz1t_0876
   00360 Phenylalanine metabolism
    Tmz1t_0876
   00380 Tryptophan metabolism
    Tmz1t_0876
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tmz1t_0876
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tmz1t_0876
   00281 Geraniol degradation
    Tmz1t_0876
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tmz1t_0876
   00627 Aminobenzoate degradation
    Tmz1t_0876
   00930 Caprolactam degradation
    Tmz1t_0876
Enzymes [BR:tmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tmz1t_0876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACK53643
JGI: Tmz1t_0876
UniProt: C4ZLN1
Position
complement(968984..969760)
Genome map
AA seq 258 aa AA seqDB search
MSFEMILAEKRGRVGLITLNRPKALNALNDQVVNEITAALNDFESDDGIGAIVITGSEKA
FAAGADIGAMANFSYMDAYKSEYITRNWERVKTCRKPVIAAVAGFALGGGSELAMMCDII
IAADTAKFGQPEVKLGTLPGAGGTQRLPRAVGKAKAMELCLTGRMMDAVEAERAGLVARV
VPADKLLEDALATAETIAGYSLPVVMMIKESINRAFESSLNEGLLFERRVFHSAFALNDQ
KEGMAAFVEKRKANFRHD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgagatgatcctcgccgagaaacgcggccgtgtcggcctcatcaccctcaac
cgccccaaggcgctcaacgcgctcaacgatcaggtggtgaacgagatcaccgccgccctc
aacgacttcgagtccgacgatggcatcggtgccatcgtcatcaccggctcggagaaggcc
ttcgccgcaggcgccgacatcggcgcgatggcgaacttctcctacatggatgcctacaag
agcgagtacatcacgcgcaactgggagcgcgtgaagacctgccgcaagccggtgatcgcc
gcggtggcgggctttgcgctcggcggcggcagcgagctggcaatgatgtgcgacatcatc
atcgccgcggacaccgcgaagttcggccagccggaagtcaagctcggcaccctgcccggc
gcgggcggcacgcagcgcctgccgcgcgcggtgggcaaggcgaaggcgatggagctgtgc
ctgaccggacgcatgatggacgcggtcgaagccgagcgcgccggcctggtcgcgcgcgtg
gtgccggccgacaagctgctcgaggacgcgctcgccaccgcggagaccatcgccggctac
tcgctgccggtggtcatgatgatcaaggaatcgatcaaccgcgccttcgagagcagcctc
aacgagggcctactgttcgagcgccgcgtcttccactccgcgttcgcgctcaacgaccag
aaggaaggcatggcggccttcgtcgagaagcgcaaggcgaacttccgccacgactga

DBGET integrated database retrieval system