KEGG   Thauera sp. MZ1T: Tmz1t_0900Help
Entry
Tmz1t_0900        CDS       T00804                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00340  Histidine metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Tmz1t_0900
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Tmz1t_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACK53667
JGI: Tmz1t_0900
UniProt: C4ZLQ5
Position
991829..993136
Genome map
AA seq 435 aa AA seqDB search
MSQTPIRRLAAREPEFLSTLDALLAFEAEADGRIDAAVTEILQAVRTTGDAAVVEYTRRF
DGLDVQSMVALELPRSELLLALDSLRPEQREALTIAADRVRVYHERQKGESWEFTEADGT
RLGQKVTPLDRVGLYVPGGRASYPSSVLMNAIPAKVAGVGELIMVVPTPRGEKNPLVLAA
AAITGVDRVFTIGGAQAVAALAYGTQTIPQVDKIVGPGNAYVAEAKRRVFGTVGIDMVAG
PSEVLIISDGSGHADWVAMDLFAQAEHDELAQSILLCTDAGFIDAVHDAIDRLLPTMPRR
DTIARSLANRGALIHVDSLEQACALANRIAPEHLELALEDAEDWIAHIRHAGAIFVGHWA
VEALGDYCAGPNHVLPTMRSARFSSPLGTYDFQKRTSIVHISQAGAQHLGKVASILAHGE
GLQAHARSAEMRLKV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccccgatccgccgcctggccgcgcgcgaacccgaattcctgtccaccctc
gatgccctgctcgccttcgaggccgaggccgacggccgcatcgacgcggcggtcaccgag
atcctgcaggcggtgcgcaccaccggcgacgccgcggtggtcgaatacacccgccgcttc
gacgggctcgacgtgcaatccatggtcgcgctcgagctgcccaggagcgagctgctgctc
gcgctcgacagcctgcgccccgagcagcgcgaggcgctcaccatcgccgccgaccgcgtg
cgcgtctatcacgagcgccagaagggcgagtcctgggaattcaccgaggccgacggcacc
cgcctgggccagaaggtcaccccgctcgaccgcgtcggcctctacgtgccgggcgggcgc
gcctcctacccgagctcggtgctgatgaatgcgatcccggccaaggtcgccggtgtcggc
gaactgatcatggtcgtgcccaccccgcgtggcgagaagaatccgctggtgctggcggcg
gcggcgatcaccggcgtcgaccgcgtgttcaccatcggcggcgcgcaggcggtggcggcg
ctggcctacggcacgcagaccatcccgcaggtggacaagatcgtcggcccgggcaatgcc
tacgtggccgaggccaagcgccgcgtgttcggcaccgtcggcatcgacatggtcgccggc
ccgtctgaagtgctgatcatctccgatggctccggccacgccgactgggtggcaatggac
ctcttcgcccaggccgagcacgacgagctcgcgcagtccatcctgctgtgtaccgacgcc
ggcttcatcgacgcggtgcacgacgcgatcgaccgcctgctgcccaccatgccgcgccgc
gacacgatcgccaggtcgcttgccaaccgcggcgcgctgatccacgtcgacagcctggag
caggcctgcgcgctcgccaaccgcatcgcgcccgagcacctcgagctggcgctggaagat
gccgaggactggatcgcccacatccgtcacgccggcgcgatcttcgtcggccactgggcg
gtggaggcgctcggcgactactgcgccggccccaaccacgtgctgccgaccatgcgcagc
gcgcgtttctcctcgccgctcggcacctacgacttccagaagcgcaccagcatcgtccac
atctcgcaggcgggcgcgcagcacctgggcaaggtggcttccatcctggcccatggcgag
ggtctgcaggcgcacgcccgctcggcggagatgcggctgaaggtttga

DBGET integrated database retrieval system