KEGG   Thauera sp. MZ1T: Tmz1t_1206Help
Entry
Tmz1t_1206        CDS       T00804                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmz1t_1206
   00030 Pentose phosphate pathway
    Tmz1t_1206
   00051 Fructose and mannose metabolism
    Tmz1t_1206
   00052 Galactose metabolism
    Tmz1t_1206
   00500 Starch and sucrose metabolism
    Tmz1t_1206
   00520 Amino sugar and nucleotide sugar metabolism
    Tmz1t_1206
  Nucleotide metabolism
   00230 Purine metabolism
    Tmz1t_1206
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tmz1t_1206
Enzymes [BR:tmz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Tmz1t_1206
    5.4.2.8  phosphomannomutase
     Tmz1t_1206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1336571..1337968)
Genome map
AA seq 465 aa AA seqDB search
MRHPLPAAELFKAYDIRGIVDTVLTPTAVRAIGHAIGSEAAVRGQRAIAVGRDGRLSGPA
LAGALTAGIRAAGIDVIDIGCVPTPLTYFAAFELGCASCVSVTGSHNPPAYNGLKIVLDG
RTLHGEAIQDLRRRIAEDDLVEGAGALRGADVRAAYLDRIVGDIELARPLKIVLDCGNGV
AGAVAPELFRRLGCELVELFCEVDGRFPNHHPDPSRPENLQDVIRALRETDAELGLAFDG
DGDRLGVVCKDGEIVFPDRQLMLFAADVLARVPGGEILYDVKCTRNLAPWIRAHGGRPTM
WKTGHALLKAKLQETGAALAGEMSGHMFFKERWYGFDDGLYAGARLLEILSARADANAAL
KALPDATSTPELNLKMQEGEPFELVRRLREAALATPSCFAEAREVITLDGLRVEFAHGFG
LARPSNTTPMVVLRFEADDAAALASIEAAFRRALDAVWPGLALPF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgcgccaccccctgcccgcagcagagcttttcaaggcctacgacatccgcggcatcgtc
gacaccgtgctgactcccacggcggtgcgcgcgatcggccacgcgatcggctccgaagcc
gcggtgcgcggccagcgcgcgatcgcggtgggccgcgacggccgcctgtccggcccggcg
ctggccggcgcgctgaccgcgggcatccgcgccgccggcatcgacgtgatcgacatcggc
tgcgtgcccaccccgctcacctacttcgccgccttcgagctcggctgcgcctcctgcgtg
tcggtcaccggcagccacaacccgcccgcctacaacggcctcaagatcgtgctcgacggc
cgcaccctgcacggcgaggcgatccaggacctgcgccggcgcatcgccgaggatgacctc
gtcgagggtgccggcgcgctgcgcggcgccgacgtgcgcgccgcctacctcgaccgcatc
gtcggcgacatcgagctcgcgcgcccgctgaagatcgtgctcgactgcggcaacggcgtg
gccggcgccgtcgcgcccgaactcttccgccgcctgggctgcgagctcgtcgagctgttc
tgcgaggtcgacggccgctttcccaatcaccaccccgacccgtcgcggccggagaacctg
caggacgtcatccgcgcgctgcgcgagaccgacgccgagctgggcctggccttcgacggc
gacggcgaccgcctcggcgtggtgtgcaaggacggcgagatcgtcttcccggatcgccag
ctcatgctcttcgccgcggacgtactcgcccgcgtaccgggcggcgagatcctctacgac
gtcaagtgcacccgcaatctggcaccgtggatccgcgcgcacggcggccggccgacgatg
tggaagaccggccacgcgctgctcaaggcgaagctgcaggagaccggcgccgcactcgcc
ggcgagatgagcggccacatgttcttcaaggagcgctggtacggcttcgacgacggcctc
tacgcgggcgcccgcctgctcgagatcctctccgcccgcgccgacgccaacgccgcgctg
aaggcgctgcccgacgcgacgagcaccccggagctgaacctgaagatgcaggagggcgag
cccttcgagctggtgcgccggctgcgcgaggccgcgctcgccacgccctcgtgcttcgcc
gaagcgcgcgaggtgatcacgctcgacggcctgcgggtggagttcgcccacggcttcggc
ctcgcccgcccctcgaacaccacgccgatggtggtgctgcgcttcgaggccgacgacgcc
gcggcgctcgcctcgatcgaggcggcgttccggcgcgcgctcgacgcagtctggcccgga
ctcgcgctgccgttctga

DBGET integrated database retrieval system