KEGG   Thauera sp. MZ1T: Tmz1t_1242Help
Entry
Tmz1t_1242        CDS       T00804                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tmz1t_1242
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tmz1t_1242
Exosome [BR:tmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tmz1t_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1374576..1376069
Genome map
AA seq 497 aa AA seqDB search
MAYLLALDQGTTSSRAIVFDADGRVRGLAQQAFAQHFPAPDRVEHDPQDILRTQLDCARE
ALANAGVAAREVAAIGIANQRETTVLWERASGRALAPAIVWQDRRTAVECERLRAAGCAE
DVRARTGLELDPYFSATKLAWLLDHVPDARVRAERGELAFGTIDSWLLWHLSGGRLHLTD
AGNAARTLLFNLHTLDWDPVLLKRFRIPPVLLPRVVASSGVCGETDPALFGAAIPIAGIG
GDQQAATFGQACLAPGMAKNTYGTGCFLLMNTGHVPVASAHRLLTTVGWTGVDAAPSYAL
EGSVFMGGAVVQWLRDGLGLVKRASEVEALAASVPDSGGVVLVPAFTGLGAPYWDPHARG
TLLGLSRGSGAAHIARAALEAIAMQSADLVQAMARDGAAPLAELRVDGGAAANDLLMQMQ
ADLLGVPVLRPRLLETTAFGAACLAALGCGLWKRPQEIATHWQLDRRFEPRWPAARRDEA
RAVWVRAVERARAWAQD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcctacctgctcgccctcgaccagggcaccaccagctcgcgcgcgatcgtgttcgac
gccgatggccgcgtgcgcggcctcgcccagcaggcattcgcgcagcacttccctgcgccc
gaccgggtcgagcacgatccccaggacatcctgcgtacccagctcgactgcgcccgcgag
gcgctcgccaatgccggcgtggccgcacgcgaggtggcggcgatcggcatcgccaaccag
cgcgagaccaccgtgctgtgggagcgcgccagtggacgcgccctcgcccccgcgatcgtc
tggcaggaccgccgcaccgcggtagagtgcgagcgcctgcgcgccgcgggctgcgcagag
gacgtgcgcgcgcgcaccgggctggagctcgatccctatttctccgccaccaagctcgcc
tggctgctcgaccacgttcccgatgcgcgcgtgcgcgccgagcgcggcgagctcgccttc
ggcaccatcgacagctggctgctgtggcatctgagcggcggccggctgcacctgaccgat
gcgggcaacgccgcgcgcacgctgctcttcaacctccacacgctggactgggatccggtg
ttgctcaagcgcttccgcatcccgcccgtgctgctgccgcgcgtggtggcgagcagcggg
gtgtgcggcgagaccgatccggcgctgttcggtgccgcgatcccgatcgccggcatcggc
ggcgaccagcaggcggcgaccttcggccaggcctgcctcgccccgggcatggcgaagaac
acctacggcaccggctgcttcctgctcatgaacaccggccatgtgccggtggcgtccgcg
caccggctattgaccaccgtggggtggaccggggtggatgcggcgcccagctacgcgctc
gagggcagcgtgttcatgggcggtgcggtggtgcagtggttgcgtgacggcctcgggctg
gtgaagcgcgcgtccgaggtcgaggccttggcggcgagcgtgcccgacagcggtggggtg
gtgctggtgccggccttcaccgggctgggcgcgccgtactgggacccgcacgcgcgcggc
accctgctcggcctgtcgcgtggcagcggtgcggcgcacatcgcgcgtgcggcactggag
gcgatcgccatgcagagcgccgacctcgtccaggcgatggcacgcgacggcgccgcgccg
ctcgccgagctgcgcgtcgatggcggcgccgcggccaacgacctgctgatgcagatgcag
gccgacctgctcggcgtgccggtgctgcgtccgcgcctgctcgagaccaccgccttcggc
gccgcctgcctggctgcgcttggctgcgggctgtggaagcggccgcaggagatcgccacg
cactggcaactcgaccgccgcttcgagccgcgctggccggcggcacggcgcgacgaggca
cgcgccgtgtgggtgcgcgcggtcgagcgtgcgcgggcgtgggcgcaggactga

DBGET integrated database retrieval system