KEGG   Thauera sp. MZ1T: Tmz1t_1247Help
Entry
Tmz1t_1247        CDS       T00804                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmz1t_1247
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tmz1t_1247
Enzymes [BR:tmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Tmz1t_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1380683..1381996)
Genome map
AA seq 437 aa AA seqDB search
MTLTREQQIAALEKDWAENPRWKGIKRGYSAADVVRLRGSLQPEYTLAQRGAKLLWERVN
GGAKKGYVNAFGAITAGQAMQQAKAGLEAVYLSGWQVAADGNTSETMYPDQSLYAYDSVP
TMVRRINNTFKRADEIQWSRGINPGDKEFVDYFLPIVADAEAGFGGVLNAFELMKNMIAA
GAAGVHFEDQLAAVKKCGHMGGKVLVPTQEACEKLIAARFAADVMGVPTIILARTDAEAA
NLITSDHDANDKPFLTGERTQEGFYRVKNGLEQSISRGVAYAPYADLVWCETGTPDLGFA
REFAQAVHAAHPGKLLSYNCSPSFNWKKNLDDKTIAKFQDELSALGYKYQFITLAGIHIN
WFNTFKFAHAYARGEGMKHYTEMVQEPEFAAREQGYTFVSHQQEVGAGYFDDVTTVIQGG
SSSVKALTGSTEEEQFH
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgacccgcgaacagcaaatcgccgccctcgaaaaagactgggccgagaatccc
cgttggaaaggcatcaagcgcggctactccgcggccgacgtggtccgcctgcgtggcagc
ctgcagcccgagtacaccctggcccagcgtggtgccaagctgctgtgggagcgtgtcaat
ggcggcgccaagaagggctatgtgaacgccttcggcgcgatcaccgccggtcaggcgatg
cagcaggccaaggccggtctcgaagccgtgtatctgtccggctggcaggtcgccgccgac
ggcaacacctccgagaccatgtatcccgaccagtcgctgtacgcctacgactcggtcccg
accatggttcgccgcatcaacaacaccttcaagcgtgccgacgagatccagtggtcgcgt
ggcatcaacccgggcgacaaggaattcgtcgactacttcctgccgatcgtcgccgacgcc
gaggccggtttcggcggcgtgctgaacgccttcgagctgatgaagaacatgatcgccgcc
ggcgccgccggtgtgcatttcgaagaccagctcgctgccgtgaagaagtgcggccacatg
ggcggcaaggtgctggtgccgacccaggaagcctgcgagaagctgatcgccgcccgcttc
gccgccgacgtcatgggtgtgccgaccatcatcctggcccgcaccgacgccgaagccgcc
aacctcatcacctccgaccacgacgccaacgacaagcccttccttaccggtgagcgcacc
caggaaggcttctaccgtgtcaagaacggcctcgagcaatcgatcagccgcggcgtcgcc
tacgccccctacgccgacctggtgtggtgcgagaccggtaccccggacctgggcttcgcc
cgcgagttcgcccaggccgtgcatgccgcccaccccggcaagctgctgtcctacaactgc
tcgccgtccttcaactggaagaagaacctggacgacaagaccatcgccaagttccaggac
gaactctcggcgctgggctacaagtaccagttcatcaccctggccggcatccacatcaac
tggttcaacaccttcaagttcgcccacgcctacgcccgcggcgaaggcatgaagcactac
accgagatggtgcaggaaccggaattcgccgctcgcgagcagggctacaccttcgtgtcg
caccagcaggaagtcggcgccggctacttcgacgacgtcaccaccgtgatccagggtggc
tcgtcctcggtcaaggcgctgacgggctcgaccgaagaagagcagttccactaa

DBGET integrated database retrieval system