KEGG   Thauera sp. MZ1T: Tmz1t_1322Help
Entry
Tmz1t_1322        CDS       T00804                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tmz  Thauera sp. MZ1T
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tmz1t_1322
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Tmz1t_1322
Enzymes [BR:tmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Tmz1t_1322
Two-component system [BR:tmz02022]
 CheA family
  CheA-CheYBV
   Tmz1t_1322
Bacterial motility proteins [BR:tmz02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Tmz1t_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1457053..1458327
Genome map
AA seq 424 aa AA seqDB search
MNAPIRVLVVDDSAVVRQVVSEILSAAPGIEVVGTASDPLFAMAKMRRDWPDVITLDVEM
PRMDGISFLRQLMAERPTPVIVCSTLTSRGAETTMQALAAGAVSIIAKPTLGLKGFLTDS
AQELVAAVRAAARANLRALRAGAGVGGGGPGVGGRAGSGAEIGSATGPGGAGVAAAPGVG
VAAARGAAGAGPAGSGARGGSNGAPGGALARPAAATAIVPAAVAPARAEAMAETTDRIIA
LGTSTGGTQALEAVLRGLPRTVPGIVVVQHMPEKFTAMFAQRLDQVCALEVLEARDGQRV
LPGRVLIAPGGRHMTVRRSGAQYLVEVRDGPPVNRHRPSVDVLFRSVARCAGRNALGVIM
TGMGDDGARGLREMFDAGAQTIAQDEASSVVFGMPKEAIRLGAATRILALQAIGPAIEQY
TRAS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccccatccgtgtcctcgtcgtcgacgactccgccgtggtgcgccaggtggtg
agcgagatcctctccgccgcacccggcatcgaggtcgtcggcaccgcctccgatccgctc
ttcgccatggccaagatgcgccgcgactggcccgacgtgatcaccctggacgtggagatg
ccgcgcatggacggcatcagcttcctgcgccagctcatggccgagcgcccgaccccggtc
atcgtgtgctccacgctcacctcgcgcggcgccgagaccaccatgcaggcgctcgccgcc
ggcgccgtctccatcatcgccaagcccacgctcggcctgaagggcttcctcaccgactcc
gcccaggaactcgtcgccgccgtgcgcgccgcggcgcgtgcgaacctgcgcgcgctacgg
gcgggggcgggcgtcggcgggggtggtcccggcgttggtggtcgagcagggtccggagcg
gaaatcggctccgcaacggggcctggcggagcgggcgtggctgccgctccgggcgtcggc
gtggcggccgcgcgcggtgcagcgggcgccggaccggccgggtcgggcgcgcgcggcgga
tcgaacggcgcgcccggcggcgcgctcgcgcgcccggccgcggcgaccgcgatcgtgccc
gccgccgtggcgcccgcgcgcgccgaggccatggccgagaccaccgaccgcatcatcgcg
ctcggcacctccaccggcggcacccaggccctcgaggcggtgctgcgcggcctgccgcgc
accgtgcccggcatcgtcgtggtgcagcacatgccggagaagttcaccgcgatgttcgcc
cagcgcctcgaccaggtgtgcgccctcgaggtgctcgaggcccgggacggacagcgcgtc
ctccccggacgggtgctcatcgcacccggcgggcgccacatgacggtgcggcgcagcggc
gcgcaatacctcgtcgaggtgcgcgacggcccgccggtgaaccgccaccgcccctcggtc
gacgtgctcttccgctcggtcgcccgctgcgccgggcgcaacgcgcttggcgtgatcatg
accggcatgggcgacgacggcgcccgcggcctgcgcgagatgttcgacgccggcgcccag
accatcgcccaggacgaggccagctccgtggtcttcggcatgcccaaggaagccatccgc
ctcggtgcggccacccgcatcctcgcgctccaggccatcggccccgccatcgagcaatac
acccgcgccagctga

DBGET integrated database retrieval system