KEGG   Thauera sp. MZ1T: Tmz1t_1322Help
Entry
Tmz1t_1322        CDS       T00804                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tmz  Thauera sp. MZ1T
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tmz02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tmz02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1457053..1458327
Genome map
AA seq 424 aa AA seqDB search
MNAPIRVLVVDDSAVVRQVVSEILSAAPGIEVVGTASDPLFAMAKMRRDWPDVITLDVEM
PRMDGISFLRQLMAERPTPVIVCSTLTSRGAETTMQALAAGAVSIIAKPTLGLKGFLTDS
AQELVAAVRAAARANLRALRAGAGVGGGGPGVGGRAGSGAEIGSATGPGGAGVAAAPGVG
VAAARGAAGAGPAGSGARGGSNGAPGGALARPAAATAIVPAAVAPARAEAMAETTDRIIA
LGTSTGGTQALEAVLRGLPRTVPGIVVVQHMPEKFTAMFAQRLDQVCALEVLEARDGQRV
LPGRVLIAPGGRHMTVRRSGAQYLVEVRDGPPVNRHRPSVDVLFRSVARCAGRNALGVIM
TGMGDDGARGLREMFDAGAQTIAQDEASSVVFGMPKEAIRLGAATRILALQAIGPAIEQY
TRAS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccccatccgtgtcctcgtcgtcgacgactccgccgtggtgcgccaggtggtg
agcgagatcctctccgccgcacccggcatcgaggtcgtcggcaccgcctccgatccgctc
ttcgccatggccaagatgcgccgcgactggcccgacgtgatcaccctggacgtggagatg
ccgcgcatggacggcatcagcttcctgcgccagctcatggccgagcgcccgaccccggtc
atcgtgtgctccacgctcacctcgcgcggcgccgagaccaccatgcaggcgctcgccgcc
ggcgccgtctccatcatcgccaagcccacgctcggcctgaagggcttcctcaccgactcc
gcccaggaactcgtcgccgccgtgcgcgccgcggcgcgtgcgaacctgcgcgcgctacgg
gcgggggcgggcgtcggcgggggtggtcccggcgttggtggtcgagcagggtccggagcg
gaaatcggctccgcaacggggcctggcggagcgggcgtggctgccgctccgggcgtcggc
gtggcggccgcgcgcggtgcagcgggcgccggaccggccgggtcgggcgcgcgcggcgga
tcgaacggcgcgcccggcggcgcgctcgcgcgcccggccgcggcgaccgcgatcgtgccc
gccgccgtggcgcccgcgcgcgccgaggccatggccgagaccaccgaccgcatcatcgcg
ctcggcacctccaccggcggcacccaggccctcgaggcggtgctgcgcggcctgccgcgc
accgtgcccggcatcgtcgtggtgcagcacatgccggagaagttcaccgcgatgttcgcc
cagcgcctcgaccaggtgtgcgccctcgaggtgctcgaggcccgggacggacagcgcgtc
ctccccggacgggtgctcatcgcacccggcgggcgccacatgacggtgcggcgcagcggc
gcgcaatacctcgtcgaggtgcgcgacggcccgccggtgaaccgccaccgcccctcggtc
gacgtgctcttccgctcggtcgcccgctgcgccgggcgcaacgcgcttggcgtgatcatg
accggcatgggcgacgacggcgcccgcggcctgcgcgagatgttcgacgccggcgcccag
accatcgcccaggacgaggccagctccgtggtcttcggcatgcccaaggaagccatccgc
ctcggtgcggccacccgcatcctcgcgctccaggccatcggccccgccatcgagcaatac
acccgcgccagctga

DBGET integrated database retrieval system