KEGG   Thauera sp. MZ1T: Tmz1t_1401Help
Entry
Tmz1t_1401        CDS       T00804                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tmz  Thauera sp. MZ1T
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tmz03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1561047..1561640
Genome map
AA seq 197 aa AA seqDB search
MSPSSLDELIEALRCLPGVGPKSAQRMAYHLLQRDQRGAARLGNALLHALEVLRHCARCN
SFTEDEVCPRCANPRRDAALLCVVEMPADLAMIEQTQSYNGLYYVLMGRLSPLDGVGPRE
LRLDKLIARATEEGVREVILATNFTNEGEATAHTVASLLGARGVKVSRLSRGVPVGGELE
HTDIGTIGQALIERRAV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccttccagcctcgacgaactgatcgaggcactgcgctgcctgcccggggtcggc
cccaagtcggcgcagcgcatggcctatcatctgctgcagcgtgatcagcgcggcgcggcg
cggctgggcaatgccctgctgcatgcgctcgaggtgctgcgccattgcgcgcgctgcaac
agcttcaccgaggacgaggtgtgtccgcgctgcgccaatccgcgccgcgacgccgcgctg
ctgtgcgtggtggagatgccggccgatctcgccatgatcgagcagacgcagtcctacaac
ggcctctactacgtgctgatgggccggctttcgccgctcgatggcgtcgggccgcgcgaa
ctgcgcctggacaagctgatcgcgcgcgccaccgaggagggggtgcgcgaggtcatcctc
gccaccaacttcaccaacgagggcgaggccaccgcgcacaccgtcgcgagcctgctcggc
gcgcgcggggtcaaggtcagccggctgtcgcgcggcgtcccggtcggcggcgagctcgag
cataccgacatcggcaccatcggccaggctctgatcgagcgccgcgcggtctga

DBGET integrated database retrieval system