KEGG   Thauera sp. MZ1T: Tmz1t_1412Help
Entry
Tmz1t_1412        CDS       T00804                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00010  Glycolysis / Gluconeogenesis
tmz00620  Pyruvate metabolism
tmz00640  Propanoate metabolism
tmz00680  Methane metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
tmz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmz1t_1412
   00620 Pyruvate metabolism
    Tmz1t_1412
   00640 Propanoate metabolism
    Tmz1t_1412
  Energy metabolism
   00680 Methane metabolism
    Tmz1t_1412
Enzymes [BR:tmz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tmz1t_1412
Lipid biosynthesis proteins [BR:tmz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tmz1t_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACK54171
JGI: Tmz1t_1412
UniProt: C4ZNK8
Position
1572414..1574177
Genome map
AA seq 587 aa AA seqDB search
MQRPAIIHKTAADLAVPPNLADYAATCAGFSWDAARAELAGLPGGGLNIAHEAVERHAHG
PLRERIAFRFLGENSLRDVGYGELSRLTSRFANVLRTLGVRRGERVFVLTGRIPELYIAV
LGGLKAGCVVSPLFSAFGPEPIATRIGIGEGAVLVTTDLLYERKVAKLRDRLPSLRHVLL
VGEEDGATAIPATQDLAMLMAQAADTFETVATRPEDLALLHFTSGTTGTPKGAMHVHGAV
LTHWATGRYALDLHDGDIFWCTADPGWVTGTSYGIVAPLLHGVSSIVDVADFDAERWYRI
LQEQRVSVWYTAPTAIRMLMKAGPELARGFSFPRLRFVASVGEPLNPEAVWWGRDVLGKP
IHDNWWQTETGGIMIANLPALDIKPGSMGKPLPGVEAAIVRPREGGGVEFVDAPDEEGEL
ALKRGWPSMLRGYLNNEERYRKCFAGDWYLTGDLARRDADGYYWFVGRSDDVIKSAGHLI
GPFEVESALMEHPAVAEAGVIGKPDDMVGEVVKAFVSLKQGFEPSEALRKELLGHARKKL
GAAVAPKEIDFLPVLPRTRSGKIMRRLLKARELGLPEGDTSTLEAGA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccccgcgatcatccacaagacggccgccgatctggccgtgccgcccaatctt
gccgactacgccgcgacctgtgccggcttctcctgggacgcggcgcgcgccgagctggcg
gggctgcccggcggcgggctcaacatcgcccatgaggcggtcgagcgccacgcgcatggc
ccgctgcgcgagcgcatcgccttccgtttcctcggtgagaactcgctccgtgatgtcggc
tacggcgagctgtcgcgcctcaccagccgcttcgccaacgtgctgcggaccctgggcgtg
cggcgcggcgagcgtgtcttcgtgctgaccgggcgcatcccggagctgtacatcgcggtg
ctcggcggcctgaaggcgggctgtgtggtgtcgccgctgttctccgccttcggcccggag
ccgatcgcgacccggatcggcatcggcgagggggcagtgctggtcaccaccgacctgctg
tacgagcgcaaggtggcgaagctgcgtgatcgcctgccgagcctgcgccatgtcctgctg
gtgggtgaggaggatggcgcgacggccatccccgccacccaggacctcgcgatgctgatg
gcgcaggccgcggacacgttcgagacggtggcgacccggcccgaagacctcgccctgctg
cacttcaccagcggcaccaccggcacgcccaagggtgccatgcacgtgcatggcgcggtc
ctcacccactgggcgaccggccgctacgcgctcgatctgcatgatggcgacatcttctgg
tgcaccgccgaccccggctgggtcaccggcacctcctacggcatcgtcgcgccgctgctg
cacggcgtgagctccatcgtcgacgtggccgacttcgatgccgagcgctggtaccgcatc
ctgcaggagcagcgggtcagcgtctggtacaccgcccccaccgcgatccgcatgctgatg
aaggccgggccggagctggcgcgcggtttttccttcccccgcctgcgcttcgtcgccagc
gtgggcgagccgctcaatcccgaggcggtgtggtggggccgcgacgtgctcggcaagccg
atccacgacaactggtggcagaccgagaccggcggcatcatgatcgccaaccttcccgcg
ctcgacatcaagcccggctcgatgggaaagcccttgcccggtgtcgaggcggcgatcgtg
cgtccgcgcgaaggcggcggcgtggagttcgtcgatgcgcccgacgaggagggcgaactg
gccctgaagcgtggttggccatcgatgctgcgcggctacctgaacaacgaggagcgctac
cgcaagtgcttcgccggcgactggtacctgaccggcgacctggcgcggcgcgatgccgac
ggctactactggttcgtcggccgcagcgacgacgtgatcaagtcggccggccacctgatc
gggcccttcgaggtcgagagcgcgctgatggagcatccggcggtggccgaggccggcgtc
atcggcaagcccgacgacatggtcggcgaggtggtgaaggccttcgtgtcgctgaagcag
ggcttcgagccttcggaggcgctgcgcaaggagctgctcggtcatgcgcgcaagaagctc
ggcgcggcggtggcacccaaggagatcgacttcctgccggtgctgccgcgcacgcgcagc
ggcaagatcatgcgccggctgctgaaggcgcgcgaactcggcctgcccgaaggcgacacc
tccacgctggaggccggagcatga

DBGET integrated database retrieval system