KEGG   Thauera sp. MZ1T: Tmz1t_1532Help
Entry
Tmz1t_1532        CDS       T00804                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tmz  Thauera sp. MZ1T
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tmz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1711795..1712811
Genome map
AA seq 338 aa AA seqDB search
MRPTGAFPATRMRRMRRDEFSRRLMREHVLTANDLIYPVFVLDGTDRSEAVPSMPGVERV
SIDRLLGVAEEAMRLGVPALALFPVIDRAGKTPGAEEAWNPEGLVPRTVQALKANFPDLG
VITDVALDPYTSHGQDGLIDPADPRGYVMNDETLEALAKQALCHAQAGADVVAPSDMMDG
RIGRIRAELDGAGHIHTRILAYSAKYASSFYGPFRDAVGSAGNLGKGNKHTYQMDPGNSD
EALREVELDIAEGADMFMVKPGMPYLDIVRRVKQELQVPTYAYQVSGEYAMLKAAAANGW
LDERACALEALLSFKRAGADGILTYFALDAARWLKAGA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgacccactggagcctttcccgcgacccgcatgcgccgcatgcgccgtgacgaattt
tcccgccgtctgatgcgcgagcacgtactcaccgccaacgacctgatctatccggtgttc
gtgctcgacggcaccgaccgcagcgaggccgtgccctcgatgcccggtgtcgagcgtgtg
agcatcgaccggctgttgggcgtggccgaggaggcgatgcgcctgggcgtgccggcgctc
gcgctgttcccggtgatcgaccgcgccggcaagacccccggcgccgaggaggcctggaat
ccggagggcttggtgccgcgcaccgtgcaggcgctcaaggcgaacttccccgacctgggc
gtgatcaccgacgtggcgctcgatccctacaccagccacggccaggacggtctcatcgac
cccgccgacccgcgcggctacgtgatgaacgacgagaccctggaggcgctcgccaagcag
gccctgtgccacgcccaggccggcgccgatgtcgtggcgccttccgacatgatggatggc
cgcatcggccgcatccgcgccgagctggacggcgcgggccacatccacacccgcatcctg
gcctactctgcaaagtacgcctcgagcttctacggccccttccgcgacgcggtgggctcg
gccggcaacctcggcaagggcaacaagcacacctatcagatggacccgggcaacagcgac
gaggccctccgcgaggtcgagctcgatatcgccgagggtgccgacatgttcatggtgaag
cccggcatgccctacctcgacatcgtgcgccgcgtgaagcaggagctgcaggtgccgacc
tacgcctaccaggtcagcggcgagtacgccatgctcaaggccgccgcggccaacggctgg
ctggacgagagggcgtgcgcgctcgaggccctgctgtccttcaagcgcgccggcgccgac
ggcatcctgacctatttcgcgctcgacgcggcgcgctggcttaaggccggcgcctga

DBGET integrated database retrieval system