KEGG   Thauera sp. MZ1T: Tmz1t_1591Help
Entry
Tmz1t_1591        CDS       T00804                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tmz  Thauera sp. MZ1T
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tmz1t_1591
   00670 One carbon pool by folate
    Tmz1t_1591
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Tmz1t_1591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1775950..1776444)
Genome map
AA seq 164 aa AA seqDB search
MKKPEIVLIAAVARNGTIGRDNELPWRLKADLQHFRALTLGHPILMGRKTWQSLGRPLPG
RRNLVVSRTPDYRAEGAECFADPAAAIAAAGEAQTLFVIGGAQLYAQLLPLADRLELTEV
KADVEGDAHFPAVDPARFVEERRETHHADADNAFDFDFVRYCRR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcccgagatcgtcctcatcgccgcggtcgcgcgcaacggcacgatcggccgc
gataacgagctgccctggcggctgaaggccgacctgcagcatttccgtgccctcaccctg
gggcacccgatcctgatggggcgcaagacctggcaatcgctcggccgcccgctgccagga
cggcgcaacctcgtggtgagccgtacgccggattaccgtgccgaaggcgccgaatgcttc
gccgaccccgcggccgcgatcgccgcggccggcgaggcccagacactgttcgtgatcggc
ggcgcccaactttacgcccagctgcttcccctcgccgaccgcctcgagctcaccgaggtg
aaagccgacgtcgagggcgatgcgcacttccccgccgtcgatccggcgcggttcgtcgag
gagcgtcgcgagacacaccacgccgacgccgacaacgccttcgacttcgatttcgtgcgc
tactgccggcgctga

DBGET integrated database retrieval system