KEGG   Thauera sp. MZ1T: Tmz1t_1630Help
Entry
Tmz1t_1630        CDS       T00804                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00330  Arginine and proline metabolism
tmz00332  Carbapenem biosynthesis
tmz01100  Metabolic pathways
tmz01130  Biosynthesis of antibiotics
tmz01230  Biosynthesis of amino acids
Module
tmz_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tmz1t_1630
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Tmz1t_1630
Enzymes [BR:tmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tmz1t_1630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SAM_2
Motif
Other DBs
NCBI-ProteinID: ACK54385
JGI: Tmz1t_1630
UniProt: C4ZJK3
Position
complement(1827526..1828641)
Genome map
AA seq 371 aa AA seqDB search
MRTKLRNARRLVVKVGSALVTNNGAGLDKDALDAWARQIAALRAEGREIALVSSGAIAAG
MQRLGWAKRPTEMSKLQAAAAVGQMGLVEAYEKAFSRHGLHTAQILLTHEDLADRSRYLN
ARSTLTTLLALGVVPIINENDTVVTDEIKFGDNDTLGALVANLIEAEALIILTDQQGLYT
ADPRKDPAATLIGEGRAEDRQYEAMAGGSGSAISKGGMITKIRAAQRAARSGAHTCIASG
REPDPILRLAAGEALGTLLYASSTPLQARKQWLADHLQLAGDLVIDDGAVAALKSGKSLL
PVGVVEARGDFERGAVVACRNLAGEEVARGLVNYSASECRRIARKPTAEIANLIGYLDEP
ELVHRDNMVRT
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccaagctccgcaacgcccgccgcctcgtggtcaaggtcggctccgcactcgtc
accaacaacggcgccggtctcgacaaggacgcgctcgacgcctgggcgcgccagatcgcc
gcgctgcgcgccgagggccgcgagatcgcgctcgtgtcctcgggcgcgatcgccgccggc
atgcagcgcctgggctgggcgaagcgcccgaccgagatgagcaagctgcaggccgccgcc
gcggtcggccagatgggactggtggaagcctacgaaaaggccttctcgcgccacggcctg
cacaccgcgcagatcctgctcacccacgaggatctcgccgaccgcagccgctacctcaac
gcgcgcagcaccctcacgacgctgctcgcgctcggcgtggtgccgatcatcaacgagaac
gacaccgtggtcaccgatgagatcaagttcggcgacaacgacaccctcggcgcgctcgtc
gccaacctcatcgaggccgaggcgctcatcatcctcaccgaccagcagggcctgtacacc
gccgacccgcgcaaggacccggccgccacgctgatcggcgagggccgcgccgaggaccgc
cagtacgaggccatggccggcggctcgggcagcgcgatcagcaagggcggcatgatcacc
aagatccgcgccgcccagcgcgccgcgcgcagcggggcgcacacctgcatcgccagcggc
cgcgagcccgaccccatcctgcgcctggccgcgggcgaggcgctcggcaccctgctctac
gccagcagcacgccgctgcaggcacgcaagcagtggctggccgaccacctgcagctcgcc
ggcgacctcgtcatcgacgacggcgcggtggcggcgttgaaaagcggcaagagcctgctg
ccggtgggcgtggtcgaggcgcgtggggatttcgagcgcggcgcggtggtggcctgccgc
aacctggccggcgaggaagtcgcgcgcgggctggtgaactactccgcttcggaatgccgg
cgcatcgcgcgcaagccgaccgcggagatcgcgaacctgatcggctacctcgacgagccg
gaactggtgcatcgggacaacatggtccgtacgtga

DBGET integrated database retrieval system