KEGG   Thauera sp. MZ1T: Tmz1t_1740Help
Entry
Tmz1t_1740        CDS       T00804                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmz1t_1740
   01230 Biosynthesis of amino acids
    Tmz1t_1740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmz1t_1740
   00051 Fructose and mannose metabolism
    Tmz1t_1740
   00562 Inositol phosphate metabolism
    Tmz1t_1740
Enzymes [BR:tmz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tmz1t_1740
Exosome [BR:tmz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tmz1t_1740
  Exosomal proteins of bladder cancer cells
   Tmz1t_1740
  Exosomal proteins of melanoma cells
   Tmz1t_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1961415..1962152
Genome map
AA seq 245 aa AA seqDB search
MTRLVAGNWKMNGSLAANRELLDGLVSIPGVEIAVCVPYPYLAQAQQRPEGVALGAQDVS
EYAAGAYTGEVSAAMLAEFGCRYAIVGHSERRALFGEEDATVGRKALAALQAGLVPIVCV
GETLAERDEARAVEVIGRQLEAVREVLGAAAMGAVVLAYEPVWAIGTGRSASVAQVAEVH
AAIRAWLKVHGVAAGGVRILYGGSVKADNAAALFAVEDVDGGLIGGASLVAADFLAICCA
AAGGV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccagactcgttgccggtaactggaagatgaacggcagcctcgccgccaatcgcgag
ctgctcgacggcctcgtgtcgatcccgggcgtggaaatcgccgtgtgtgtgccgtatccc
tatctcgcccaggcgcaacaacggcccgagggcgtcgccctcggtgcgcaggacgtgtcg
gagtacgcggccggcgcctataccggcgaggtgagtgcggccatgctcgcggagttcggc
tgccgctacgccatcgtcggtcactccgagcgccgtgccctcttcggcgaggaagatgcc
acggtcgggcgcaaggcgctcgccgcgctgcaggctggcttggtgccgatcgtgtgcgtg
ggcgagacgctcgccgagcgcgacgaggcgcgtgcggtcgaggtgatcggccgccagctc
gaggcggtgcgcgaggtgctcggcgccgcggcgatgggtgcggtggtgctagcctacgaa
cccgtgtgggcgatcggcaccgggcgctccgcgagcgtggcgcaggtggccgaggtgcat
gctgcgatccgcgcgtggctgaaggtacacggcgtggcggcgggtggcgtccgcatcctc
tacggcggcagcgtcaaggcggacaatgccgcggcgctcttcgccgtggaggatgttgac
ggtgggctgatcggcggcgcctcgctcgtcgctgcggatttcttggccatctgctgcgcc
gcggcgggtggggtctga

DBGET integrated database retrieval system