KEGG   Thauera sp. MZ1T: Tmz1t_1740Help
Entry
Tmz1t_1740        CDS       T00804                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmz  Thauera sp. MZ1T
Pathway
tmz00010  Glycolysis / Gluconeogenesis
tmz00051  Fructose and mannose metabolism
tmz00562  Inositol phosphate metabolism
tmz01100  Metabolic pathways
tmz01110  Biosynthesis of secondary metabolites
tmz01120  Microbial metabolism in diverse environments
tmz01130  Biosynthesis of antibiotics
tmz01200  Carbon metabolism
tmz01230  Biosynthesis of amino acids
Module
tmz_M00002  Glycolysis, core module involving three-carbon compounds
tmz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmz1t_1740
   00051 Fructose and mannose metabolism
    Tmz1t_1740
   00562 Inositol phosphate metabolism
    Tmz1t_1740
Enzymes [BR:tmz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tmz1t_1740
Exosome [BR:tmz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tmz1t_1740
  Exosomal proteins of bladder cancer cells
   Tmz1t_1740
  Exosomal proteins of melanoma cells
   Tmz1t_1740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACK54492
JGI: Tmz1t_1740
UniProt: C4ZKH5
Position
1961415..1962152
Genome map
AA seq 245 aa AA seqDB search
MTRLVAGNWKMNGSLAANRELLDGLVSIPGVEIAVCVPYPYLAQAQQRPEGVALGAQDVS
EYAAGAYTGEVSAAMLAEFGCRYAIVGHSERRALFGEEDATVGRKALAALQAGLVPIVCV
GETLAERDEARAVEVIGRQLEAVREVLGAAAMGAVVLAYEPVWAIGTGRSASVAQVAEVH
AAIRAWLKVHGVAAGGVRILYGGSVKADNAAALFAVEDVDGGLIGGASLVAADFLAICCA
AAGGV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccagactcgttgccggtaactggaagatgaacggcagcctcgccgccaatcgcgag
ctgctcgacggcctcgtgtcgatcccgggcgtggaaatcgccgtgtgtgtgccgtatccc
tatctcgcccaggcgcaacaacggcccgagggcgtcgccctcggtgcgcaggacgtgtcg
gagtacgcggccggcgcctataccggcgaggtgagtgcggccatgctcgcggagttcggc
tgccgctacgccatcgtcggtcactccgagcgccgtgccctcttcggcgaggaagatgcc
acggtcgggcgcaaggcgctcgccgcgctgcaggctggcttggtgccgatcgtgtgcgtg
ggcgagacgctcgccgagcgcgacgaggcgcgtgcggtcgaggtgatcggccgccagctc
gaggcggtgcgcgaggtgctcggcgccgcggcgatgggtgcggtggtgctagcctacgaa
cccgtgtgggcgatcggcaccgggcgctccgcgagcgtggcgcaggtggccgaggtgcat
gctgcgatccgcgcgtggctgaaggtacacggcgtggcggcgggtggcgtccgcatcctc
tacggcggcagcgtcaaggcggacaatgccgcggcgctcttcgccgtggaggatgttgac
ggtgggctgatcggcggcgcctcgctcgtcgctgcggatttcttggccatctgctgcgcc
gcggcgggtggggtctga

DBGET integrated database retrieval system