KEGG   Thauera sp. MZ1T: Tmz1t_1740Help
Entry
Tmz1t_1740        CDS       T00804                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tmz  Thauera sp. MZ1T
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tmz01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tmz01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tmz00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tmz00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tmz00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1961415..1962152
Genome map
AA seq 245 aa AA seqDB search
MTRLVAGNWKMNGSLAANRELLDGLVSIPGVEIAVCVPYPYLAQAQQRPEGVALGAQDVS
EYAAGAYTGEVSAAMLAEFGCRYAIVGHSERRALFGEEDATVGRKALAALQAGLVPIVCV
GETLAERDEARAVEVIGRQLEAVREVLGAAAMGAVVLAYEPVWAIGTGRSASVAQVAEVH
AAIRAWLKVHGVAAGGVRILYGGSVKADNAAALFAVEDVDGGLIGGASLVAADFLAICCA
AAGGV
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaccagactcgttgccggtaactggaagatgaacggcagcctcgccgccaatcgcgag
ctgctcgacggcctcgtgtcgatcccgggcgtggaaatcgccgtgtgtgtgccgtatccc
tatctcgcccaggcgcaacaacggcccgagggcgtcgccctcggtgcgcaggacgtgtcg
gagtacgcggccggcgcctataccggcgaggtgagtgcggccatgctcgcggagttcggc
tgccgctacgccatcgtcggtcactccgagcgccgtgccctcttcggcgaggaagatgcc
acggtcgggcgcaaggcgctcgccgcgctgcaggctggcttggtgccgatcgtgtgcgtg
ggcgagacgctcgccgagcgcgacgaggcgcgtgcggtcgaggtgatcggccgccagctc
gaggcggtgcgcgaggtgctcggcgccgcggcgatgggtgcggtggtgctagcctacgaa
cccgtgtgggcgatcggcaccgggcgctccgcgagcgtggcgcaggtggccgaggtgcat
gctgcgatccgcgcgtggctgaaggtacacggcgtggcggcgggtggcgtccgcatcctc
tacggcggcagcgtcaaggcggacaatgccgcggcgctcttcgccgtggaggatgttgac
ggtgggctgatcggcggcgcctcgctcgtcgctgcggatttcttggccatctgctgcgcc
gcggcgggtggggtctga

DBGET integrated database retrieval system